ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8626

Name

TP63

Synonym

AIS|B(p51A)|B(p51B)|EEC3|KET|LMS|NBP|OFC8|RHS|SHFM4|TP53CP|TP53L|TP73L|p40|p51|p53CP|p63|p73H|p73L;tumor protein p63;TP63;tumor protein p63

Definition

CUSP|amplified in squamous cell carcinoma|chronic ulcerative stomatitis protein|keratinocyte transcription factor KET|transformation-related protein 63|tumor protein 63|tumor protein p53-competing protein|tumor protein p63 deltaN isoform delta

Position

3q28

Gene Type

protein-coding

Pathways and Diseases

Pathway

p53 pathway;PANTHER;P00059

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

p53 pathway by glucose deprivation;PANTHER;P04397

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

Huntington disease;PANTHER;P00029

Pathway

P53 pathway feedback loops 1;PANTHER;P04392

Disease

urinary bladder cancer;GAD

Disease

Rapp-Hodgkin syndrome;OMIM

Disease

Orofacial cleft 8;OMIM

Disease

Split-hand/foot malformation, type 4;OMIM

Disease

Limb-mammary syndrome;OMIM

Disease

Hay-Wells syndrome;OMIM

Disease

Lung adenocarcinoma;NHGRI

Disease

ADULT syndrome;OMIM

Disease

CANCER;GAD

Disease

Brain imaging;NHGRI

Disease

Ectrodactyly, ectodermal dysplasia, and cleft lip/palate syndrome 3;OMIM

Disease

Brain imaging;GAD

Disease

proliferative potential of keratinocytes;GAD

Disease

Urinary bladder cancer;NHGRI

Disease

blastic crisis;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to cell senescence gene database

8626

Links to epithelial mesenchymal transition gene database

8626

Links to ovarian cancer gene database

8626

Links to endometrial cancer gene database

8626

Links to iHOP

8626

Sequence Information

Nucleotide Sequence

>8626 : length: 5029
AATCCTCAAATCAAACCAGTATCCAGATACAAGGAAGTGTTATGTAGCTGGAGCAGGGTG
GACACTCATCAGCTCAGTTCAGTTACAAAAGTCCAGGCTGCTGAAATTAAACTCTGATGC
CATTCATGCCAGCATCCAATCACGACAGAGATCAGAAGTTCAGAGATGCCTCCAGCTCCA
AATTGCCAACAACAAGTGTGGCTACTATACGTCAAGGACTCTGAAGCCGTGAGAGAGGGG
GAAGAACAACAGTAGAGAGGATGCCCAGCTGTTTCGTAGAAACCCCAGCTCATTTCTCTT
GGAAAGAAAGTTATTACCGATCCACCATGTCCCAGAGCACACAGACAAATGAATTCCTCA
GTCCAGAGGTTTTCCAGCATATCTGGGATTTTCTGGAACAGCCTATATGTTCAGTTCAGC
CCATTGACTTGAACTTTGTGGATGAACCATCAGAAGATGGTGCGACAAACAAGATTGAGA
TTAGCATGGACTGTATCCGCATGCAGGACTCGGACCTGAGTGACCCCATGTGGCCACAGT
ACACGAACCTGGGGCTCCTGAACAGCATGGACCAGCAGATTCAGAACGGCTCCTCGTCCA
CCAGTCCCTATAACACAGACCACGCGCAGAACAGCGTCACGGCGCCCTCGCCCTACGCAC
AGCCCAGCTCCACCTTCGATGCTCTCTCTCCATCACCCGCCATCCCCTCCAACACCGACT
ACCCAGGCCCGCACAGTTTCGACGTGTCCTTCCAGCAGTCGAGCACCGCCAAGTCGGCCA
CCTGGACGTATTCCACTGAACTGAAGAAACTCTACTGCCAAATTGCAAAGACATGCCCCA
TCCAGATCAAGGTGATGACCCCACCTCCTCAGGGAGCTGTTATCCGCGCCATGCCTGTCT
ACAAAAAAGCTGAGCACGTCACGGAGGTGGTGAAGCGGTGCCCCAACCATGAGCTGAGCC
GTGAATTCAACGAGGGACAGATTGCCCCTCCTAGTCATTTGATTCGAGTAGAGGGGAACA
GCCATGCCCAGTATGTAGAAGATCCCATCACAGGAAGACAGAGTGTGCTGGTACCTTATG
AGCCACCCCAGGTTGGCACTGAATTCACGACAGTCTTGTACAATTTCATGTGTAACAGCA
GTTGTGTTGGAGGGATGAACCGCCGTCCAATTTTAATCATTGTTACTCTGGAAACCAGAG
ATGGGCAAGTCCTGGGCCGACGCTGCTTTGAGGCCCGGATCTGTGCTTGCCCAGGAAGAG
ACAGGAAGGCGGATGAAGATAGCATCAGAAAGCAGCAAGTTTCGGACAGTACAAAGAACG
GTGATGGTACGAAGCGCCCGTTTCGTCAGAACACACATGGTATCCAGATGACATCCATCA
AGAAACGAAGATCCCCAGATGATGAACTGTTATACTTACCAGTGAGGGGCCGTGAGACTT
ATGAAATGCTGTTGAAGATCAAAGAGTCCCTGGAACTCATGCAGTACCTTCCTCAGCACA
CAATTGAAACGTACAGGCAACAGCAACAGCAGCAGCACCAGCACTTACTTCAGAAACAGA
CCTCAATACAGTCTCCATCTTCATATGGTAACAGCTCCCCACCTCTGAACAAAATGAACA
GCATGAACAAGCTGCCTTCTGTGAGCCAGCTTATCAACCCTCAGCAGCGCAACGCCCTCA
CTCCTACAACCATTCCTGATGGCATGGGAGCCAACATTCCCATGATGGGCACCCACATGC
CAATGGCTGGAGACATGAATGGACTCAGCCCCACCCAGGCACTCCCTCCCCCACTCTCCA
TGCCATCCACCTCCCACTGCACACCCCCACCTCCGTATCCCACAGATTGCAGCATTGTCA
GTTTCTTAGCGAGGTTGGGCTGTTCATCATGTCTGGACTATTTCACGACCCAGGGGCTGA
CCACCATCTATCAGATTGAGCATTACTCCATGGATGATCTGGCAAGTCTGAAAATCCCTG
AGCAATTTCGACATGCGATCTGGAAGGGCATCCTGGACCACCGGCAGCTCCACGAATTCT
CCTCCCCTTCTCATCTCCTGCGGACCCCAAGCAGTGCCTCTACAGTCAGTGTGGGCTCCA
GTGAGACCCGGGGTGAGCGTGTTATTGATGCTGTGCGATTCACCCTCCGCCAGACCATCT
CTTTCCCACCCCGAGATGAGTGGAATGACTTCAACTTTGACATGGATGCTCGCCGCAATA
AGCAACAGCGCATCAAAGAGGAGGGGGAGTGAGCCTCACCATGTGAGCTCTTCCTATCCC
TCTCCTAACTGCCAGCCCCCTAAAAGCACTCCTGCTTAATCTTCAAAGCCTTCTCCCTAG
CTCCTCCCCTTCCTCTTGTCTGATTTCTTAGGGGAAGGAGAAGTAAGAGGCTACCTCTTA
CCTAACATCTGACCTGGCATCTAATTCTGATTCTGGCTTTAAGCCTTCAAAACTATAGCT
TGCAGAACTGTAGCTGCCATGGCTAGGTAGAAGTGAGCAAAAAAGAGTTGGGTGTCTCCT
TAAGCTGCAGAGATTTCTCATTGACTTTTATAAAGCATGTTCACCCTTATAGTCTAAGAC
TATATATATAAATGTATAAATATACAGTATAGATTTTTGGGTGGGGGGCATTGAGTATTG
TTTAAAATGTAATTTAAATGAAAGAAAATTGAGTTGCACTTATTGACCATTTTTTAATTT
ACTTGTTTTGGATGGCTTGTCTATACTCCTTCCCTTAAGGGGTATCATGTATGGTGATAG
GTATCTAGAGCTTAATGCTACATGTGAGTGACGATGATGTACAGATTCTTTCAGTTCTTT
GGATTCTAAATACATGCCACATCAAACCTTTGAGTAGATCCATTTCCATTGCTTATTATG
TAGGTAAGACTGTAGATATGTATTCTTTTCTCAGTGTTGGTATATTTTATATTACTGACA
TTTCTTCTAGTGATGATGGTTCACGTTGGGGTGATTTAATCCAGTTATAAGAAGAAGTTC
ATGTCCAAACGTCCTCTTTAGTTTTTGGTTGGGAATGAGGAAAATTCTTAAAAGGCCCAT
AGCAGCCAGTTCAAAAACACCCGACGTCATGTATTTGAGCATATCAGTAACCCCCTTAAA
TTTAATACCAGATACCTTATCTTACAATATTGATTGGGAAAACATTTGCTGCCATTACAG
AGGTATTAAAACTAAATTTCACTACTAGATTGACTAACTCAAATACACATTTGCTACTGT
TGTAAGAATTCTGATTGATTTGATTGGGATGAATGCCATCTATCTAGTTCTAACAGTGAA
GTTTTACTGTCTATTAATATTCAGGGTAAATAGGAATCATTCAGAAATGTTGAGTCTGTA
CTAAACAGTAAGATATCTCAATGAACCATAAATTCAACTTTGTAAAAATCTTTTGAAGCA
TAGATAATATTGTTTGGTAAATGTTTCTTTTGTTTGGTAAATGTTTCTTTTAAAGACCCT
CCTATTCTATAAAACTCTGCATGTAGAGGCTTGTTTACCTTTCTCTCTCTAAGGTTTACA
ATAGGAGTGGTGATTTGAAAAATATAAAATTATGAGATTGGTTTTCCTGTGGCATAAATT
GCATCACTGTATCATTTTCTTTTTTAACCGGTAAGAGTTTCAGTTTGTTGGAAAGTAACT
GTGAGAACCCAGTTTCCCGTCCATCTCCCTTAGGGACTACCCATAGACATGAAAGGTCCC
CACAGAGCAAGAGATAAGTCTTTCATGGCTGCTGTTGCTTAAACCACTTAAACGAAGAGT
TCCCTTGAAACTTTGGGAAAACATGTTAATGACAATATTCCAGATCTTTCAGAAATATAA
CACATTTTTTTGCATGCATGCAAATGAGCTCTGAAATCTTCCCATGCATTCTGGTCAAGG
GCTGTCATTGCACATAAGCTTCCATTTTAATTTTAAAGTGCAAAAGGGCCAGCGTGGCTC
TAAAAGGTAATGTGTGGATTGCCTCTGAAAAGTGTGTATATATTTTGTGTGAAATTGCAT
ACTTTGTATTTTGATTATTTTTTTTTTCTTCTTGGGATAGTGGGATTTCCAGAACCACAC
TTGAAACCTTTTTTTATCGTTTTTGTATTTTCATGAAAATACCATTTAGTAAGAATACCA
CATCAAATAAGAAATAATGCTACAATTTTAAGAGGGGAGGGAAGGGAAAGTTTTTTTTTA
TTATTTTTTTAAAATTTTGTATGTTAAAGAGAATGAGTCCTTGATTTCAAAGTTTTGTTG
TACTTAAATGGTAATAAGCACTGTAAACTTCTGCAACAAGCATGCAGCTTTGCAAACCCA
TTAAGGGGAAGAATGAAAGCTGTTCCTTGGTCCTAGTAAGAAGACAAACTGCTTCCCTTA
CTTTGCTGAGGGTTTGAATAAACCTAGGACTTCCGAGCTATGTCAGTACTATTCAGGTAA
CACTAGGGCCTTGGAAATTCCTGTACTGTGTCTCATGGATTTGGCACTAGCCAAAGCGAG
GCACCCTTACTGGCTTACCTCCTCATGGCAGCCTACTCTCCTTGAGTGTATGAGTAGCCA
GGGTAAGGGGTAAAAGGATAGTAAGCATAGAAACCACTAGAAAGTGGGCTTAATGGAGTT
CTTGTGGCCTCAGCTCAATGCAGTTAGCTGAAGAATTGAAAAGTTTTTGTTTGGAGACGT
TTATAAACAGAAATGGAAAGCAGAGTTTTCATTAAATCCTTTTACCTTTTTTTTTTCTTG
GTAATCCCCTAAAATAACAGTATGTGGGATATTGAATGTTAAAGGGATATTTTTTTCTAT
TATTTTTATAATTGTACAAAATTAAGCAAATGTTAAAAGTTTTATATGCTTTATTAATGT
TTTCAAAAGGTATTATACATGTGATACATTTTTTAAGCTTCAGTTGCTTGTCTTCTGGTA
CTTTCTGTTATGGGCTTTTGGGGAGCCAGAAGCCAATCTACAATCTCTTTTTGTTTGCCA
GGACATGCAATAAAATTTAAAAAATAAATAAAAACTAATTAAGAAATTG

Protein Sequence

>8626 : length: 680
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD
FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM
DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS
FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV
VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR
KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES
LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQ
LINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP
PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWND
FNFDMDARRNKQQRIKEEGE