ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

861

Name

RUNX1

Synonym

AML1|AML1-EVI-1|AMLCR1|CBFA2|EVI-1|PEBP2aB;runt-related transcription factor 1;RUNX1;runt-related transcription factor 1

Definition

AML1-EVI-1 fusion protein|CBF-alpha-2|PEA2-alpha B|PEBP2-alpha B|SL3-3 enhancer factor 1 alpha B subunit|SL3/AKV core-binding factor alpha B subunit|acute myeloid leukemia 1 protein|core-binding factor, runt domain, alpha subunit 2|oncogene AML-1|polyomav

Position

21q22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Bone marrow disease;FunDO

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Vitamin D deficiency;FunDO

Disease

Platelet disorder, familial, with associated myeloid malignancy;OMIM

Disease

Chronic myeloid leukemia (CML);KEGG DISEASE;H00004

Disease

Leukemia, Myeloid, Acute;GAD

Disease

Down syndrome;FunDO

Disease

Stomach cancer;FunDO

Disease

Osteomyelitis;FunDO

Disease

IMMUNE;GAD

Disease

Leukemia, acute myeloid;OMIM

Disease

Rheumatoid arthritis;FunDO

Disease

Leukemia;FunDO

Disease

Asthma;GAD

Disease

Acute lymphoblastic leukemia (ALL) (Precursor B lymphoblastic leukemia);KEGG DISEASE;H00001

Disease

Thrombocytopenia;FunDO

Disease

CANCER;GAD

Disease

myeloblastic leukemias;GAD

Disease

Cancers;KEGG DISEASE

Disease

Acute myeloid leukemia (AML);KEGG DISEASE;H00003

Disease

Ovarian cancer;FunDO

Disease

Lymphoma;FunDO

Disease

Hematopoietic system disease;FunDO

External Links

Links to cell senescence gene database

861

Links to epithelial mesenchymal transition gene database

861

Links to ovarian cancer gene database

861

Links to endometrial cancer gene database

861

Links to iHOP

861

Sequence Information

Nucleotide Sequence

>861 : length: 7274
CATAGAGCCAGCGGGCGCGGGCGGGACGGGCGCCCCGCGGCCGGACCCAGCCAGGGCACC
ACGCTGCCCGGCCCTGCGCCGCCAGGCACTTCTTTCCGGGGCTCCTAGGGACGCCAGAAG
GAAGTCAACCTCTGCTGCTTCTCCTTGGCCTGCGTTGGACCTTCCTTTTTTTGTTGTTTT
TTTTTGTTTTTCCCCTTTCTTCCTTTTGAATTAACTGGCTTCTTGGCTGGATGTTTTCAA
CTTCTTTCCTGGCTGCGAACTTTTCCCCAATTGTTTTCCTTTTACAACAGGGGGAGAAAG
TGCTCTGTGGTCCGAGGCGAGCCGTGAAGTTGCGTGTGCGTGGCAGTGTGCGTGGCAGGA
TGTGCGTGCGTGTGTAACCCGAGCCGCCCGATCTGTTTCGATCTGCGCCGCGGAGCCCTC
CCTCAAGGCCCGCTCCACCTGCTGCGGTTACGCGGCGCTCGTGGGTGTTCGTGCCTCGGA
GCAGCTAACCGGCGGGTGCTGGGCGACGGTGGAGGAGTATCGTCTCGCTGCTGCCCGAGT
CAGGGCTGAGTCACCCAGCTGATGTAGACAGTGGCTGCCTTCCGAAGAGTGCGTGTTTGC
ATGTGTGTGACTCTGCGGCTGCTCAACTCCCAACAAACCAGAGGACCAGCCACAAACTTA
ACCAACATCCCCAAACCCGAGTTCACAGATGTGGGAGAGCTGTAGAACCCTGAGTGTCAT
CGACTGGGCCTTCTTATGATTGTTGTTTTAAGATTAGCTGAAGATCTCTGAAACGCTGAA
TTTTCTGCACTGAGCGTTTTGACAGAATTCATTGAGAGAACAGAGAACATGACAAGTACT
TCTAGCTCAGCACTGCTCCAACTACTGAAGCTGATTTTCAAGGCTACTTAAAAAAATCTG
CAGCGTACATTAATGGATTTCTGTTGTGTTTAAATTCTCCACAGATTGTATTGTAAATAT
TTTATGAAGTAGAGCATATGTATATATTTATATATACGTGCACATACATTAGTAGCACTA
CCTTTGGAAGTCTCAGCTCTTGCTTTTCGGGACTGAAGCCAGTTTTGCATGATAAAAGTG
GCCTTGTTACGGGAGATAATTGTGTTCTGTTGGGACTTTAGACAAAACTCACCTGCAAAA
AACTGACAGGCATTAACTACTGGAACTTCCAAATAATGTGTTTGCTGATCGTTTTACTCT
TCGCATAAATATTTTAGGAAGTGTATGAGAATTTTGCCTTCAGGAACTTTTCTAACAGCC
AAAGACAGAACTTAACCTCTGCAAGCAAGATTCGTGGAAGATAGTCTCCACTTTTTAATG
CACTAAGCAATCGGTTGCTAGGAGCCCATCCTGGGTCAGAGGCCGATCCGCAGAACCAGA
ACGTTTTCCCCTCCTGGACTGTTAGTAACTTAGTCTCCCTCCTCCCCTAACCACCCCCGC
CCCCCCCCACCCCCCGCAGTAATAAAGGCCCCTGAACGTGTATGTTGGTCTCCCGGGAGC
TGCTTGCTGAAGATCCGCGCCCCTGTCGCCGTCTGGTAGGAGCTGTTTGCAGGGTCCTAA
CTCAATCGGCTTGTTGTGATGCGTATCCCCGTAGATGCCAGCACGAGCCGCCGCTTCACG
CCGCCTTCCACCGCGCTGAGCCCAGGCAAGATGAGCGAGGCGTTGCCGCTGGGCGCCCCG
GACGCCGGCGCTGCCCTGGCCGGCAAGCTGAGGAGCGGCGACCGCAGCATGGTGGAGGTG
CTGGCCGACCACCCGGGCGAGCTGGTGCGCACCGACAGCCCCAACTTCCTCTGCTCCGTG
CTGCCTACGCACTGGCGCTGCAACAAGACCCTGCCCATCGCTTTCAAGGTGGTGGCCCTA
GGGGATGTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACTACTCG
GCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTC
AGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTCACA
AACCCACCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGCCCCGA
GAACCTCGAAGACATCGGCAGAAACTAGATGATCAGACCAAGCCCGGGAGCTTGTCCTTT
TCCGAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGGGTCAGCCCACAC
CACCCAGCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTAACCCT
CAGCCTCAGAGTCAGATGCAGGATACAAGGCAGATCCAACCATCCCCACCGTGGTCCTAC
GATCAGTCCTACCAATACCTGGGATCCATTGCCTCTCCTTCTGTGCACCCAGCAACGCCC
ATTTCACCTGGACGTGCCAGCGGCATGACAACCCTCTCTGCAGAACTTTCCAGTCGACTC
TCAACGGCACCCGACCTGACAGCGTTCAGCGACCCGCGCCAGTTCCCCGCGCTGCCCTCC
ATCTCCGACCCCCGCATGCACTATCCAGGCGCCTTCACCTACTCCCCGACGCCGGTCACC
TCGGGCATCGGCATCGGCATGTCGGCCATGGGCTCGGCCACGCGCTACCACACCTACCTG
CCGCCGCCCTACCCCGGCTCGTCGCAAGCGCAGGGAGGCCCGTTCCAAGCCAGCTCGCCC
TCCTACCACCTGTACTACGGCGCCTCGGCCGGCTCCTACCAGTTCTCCATGGTGGGCGGC
GAGCGCTCGCCGCCGCGCATCCTGCCGCCCTGCACCAACGCCTCCACCGGCTCCGCGCTG
CTCAACCCCAGCCTCCCGAACCAGAGCGACGTGGTGGAGGCCGAGGGCAGCCACAGCAAC
TCCCCCACCAACATGGCGCCCTCCGCGCGCCTGGAGGAGGCCGTGTGGAGGCCCTACTGA
GGCGCCAGGCCTGGCCCGGCTGGGCCCCGCGGGCCGCCGCCTTCGCCTCCGGGCGCGCGG
GCCTCCTGTTCGCGACAAGCCCGCCGGGATCCCGGGCCCTGGGCCCGGCCACCGTCCTGG
GGCCGAGGGCGCCCGACGGCCAGGATCTCGCTGTAGGTCAGGCCCGCGCAGCCTCCTGCG
CCCAGAAGCCCACGCCGCCGCCGTCTGCTGGCGCCCCGGCCCTCGCGGAGGTGTCCGAGG
CGACGCACCTCGAGGGTGTCCGCCGGCCCCAGCACCCAGGGGACGCGCTGGAAAGCAAAC
AGGAAGATTCCCGGAGGGAAACTGTGAATGCTTCTGATTTAGCAATGCTGTGAATAAAAA
GAAAGATTTTATACCCTTGACTTAACTTTTTAACCAAGTTGTTTATTCCAAAGAGTGTGG
AATTTTGGTTGGGGTGGGGGGAGAGGAGGGATGCAACTCGCCCTGTTTGGCATCTAATTC
TTATTTTTAATTTTTCCGCACCTTATCAATTGCAAAATGCGTATTTGCATTTGGGTGGTT
TTTATTTTTATATACGTTTATATAAATATATATAAATTGAGCTTGCTTCTTTCTTGCTTT
GACCATGGAAAGAAATATGATTCCCTTTTCTTTAAGTTTTATTTAACTTTTCTTTTGGAC
TTTTGGGTAGTTGTTTTTTTTTGTTTTGTTTTGTTTTTTTGAGAAACAGCTACAGCTTTG
GGTCATTTTTAACTACTGTATTCCCACAAGGAATCCCCAGATATTTATGTATCTTGATGT
TCAGACATTTATGTGTTGATAATTTTTTAATTATTTAAATGTACTTATATTAAGAAAAAT
ATCAAGTACTACATTTTCTTTTGTTCTTGATAGTAGCCAAAGTTAAATGTATCACATTGA
AGAAGGCTAGAAAAAAAGAATGAGTAATGTGATCGCTTGGTTATCCAGAAGTATTGTTTA
CATTAAACTCCCTTTCATGTTAATCAAACAAGTGAGTAGCTCACGCAGCAACGTTTTTAA
TAGGATTTTTAGACACTGAGGGTCACTCCAAGGATCAGAAGTATGGAATTTTCTGCCAGG
CTCAACAAGGGTCTCATATCTAACTTCCTCCTTAAAACAGAGAAGGTCAATCTAGTTCCA
GAGGGTTGAGGCAGGTGCCAATAATTACATCTTTGGAGAGGATTTGATTTCTGCCCAGGG
ATTTGCTCACCCCAAGGTCATCTGATAATTTCACAGATGCTGTGTAACAGAACACAGCCA
AAGTAAACTGTGTAGGGGAGCCACATTTACATAGGAACCAAATCAATGAATTTAGGGGTT
ACGATTATAGCAATTTAAGGGCCCACCAGAAGCAGGCCTCGAGGAGTCAATTTGCCTCTG
TGTGCCTCAGTGGAGACAAGTGGGAAAACATGGTCCCACCTGTGCGAGACCCCCTGTCCT
GTGCTGCTCACTCAACAACATCTTTGTGTTGCTTTCACCAGGCTGAGACCCTACCCTATG
GGGTATATGGGCTTTTACCTGTGCACCAGTGTGACAGGAAAGATTCATGTCACTACTGTC
CGTGGCTACAATTCAAAGGTATCCAATGTCGCTGTAAATTTTATGGCACTATTTTTATTG
GAGGATTTGGTCAGAATGCAGTTGTTGTACAACTCATAAATACTAACTGCTGATTTTGAC
ACATGTGTGCTCCAAATGATCTGGTGGTTATTTAACGTACCTCTTAAAATTCGTTGAAAC
GATTTCAGGTCAACTCTGAAGAGTATTTGAAAGCAGGACTTCAGAACAGTGTTTGATTTT
TATTTTATAAATTTAAGCATTCAAATTAGGCAAATCTTTGGCTGCAGGCAGCAAAAACAG
CTGGACTTATTTAAAACAACTTGTTTTTGAGTTTTCTTATATATATATTGATTATTTGTT
TTACACACATGCAGTAGCACTTTGGTAAGAGTTAAAGAGTAAAGCAGCTTATGTTGTCAG
GTCGTTCTTATCTAGAGAAGAGCTATAGCAGATCTCGGACAAACTCAGAATATATTCACT
TTCATTTTTGACAGGATTCCCTCCACAACTCAGTTTCATATATTATTCCGTATTACATTT
TTGCAGCTAAATTACCATAAAATGTCAGCAAATGTAAAAATTTAATTTCTGAAAAGCACC
ATTAGCCCATTTCCCCCAAATTAAACGTAAATGTTTTTTTTCAGCACATGTTACCATGTC
TGACCTGCAAAAATGCTGGAGAAAAATGAAGGAAAAAATTATGTTTTTCAGTTTAATTCT
GTTAACTGAAGATATTCCAACTCAAAACCAGCCTCATGCTCTGATTAGATAATCTTTTAC
ATTGAACCTTTACTCTCAAAGCCATGTGTGGAGGGGGCTTGTCACTATTGTAGGCTCACT
GGATTGGTCATTTAGAGTTTCACAGACTCTTACCAGCATATATAGTATTTAATTGTTTCA
AAAAAAATCAAACTGTAGTTGTTTTGGCGATAGGTCTCACGCAACACATTTTTGTATGTG
TGTGTGTGTGCGTGTGTGTGTGTGTGTGTGAAAAATTGCATTCATTGACTTCAGGTAGAT
TAAGGTATCTTTTTATTCATTGCCCTCAGGAAAGTTAAGGTATCAATGAGACCCTTAAGC
CAATCATGTAATAACTGCATGTGTCTGGTCCAGGAGAAGTATTGAATAAGCCATTTCTAC
TGCTTACTCATGTCCCTATTTATGATTTCAACATGGATACATATTTCAGTTCTTTCTTTT
TCTCACTATCTGAAAATACATTTCCCTCCCTCTCTTCCCCCCAATATCTCCCTTTTTTTC
TCTCTTCCTCTATCTTCCAAACCCCACTTTCTCCCTCCTCCTTTTCCTGTGTTCTCTTAA
GCAGATAGCACATACCCCCACCCAGTACCAAATTTCAGAACACAAGAAGGTCCAGTTCTT
CCCCCTTCACATAAAGGAACATGGTTTGTCAGCCTTTCTCCTGTTTATGGGTTTCTTCCA
GCAGAACAGAGACATTGCCAACCATATTGGATCTGCTTGCTGTCCAAACCAGCAAACTTT
CCTGGGCAAATCACAATCAGTGAGTAAATAGACAGCCTTTCTGCTGCCTTGGGTTTCTGT
GCAGATAAACAGAAATGCTCTGATTAGAAAGGAAATGAATGGTTCCACTCAAATGTCCTG
CAATTTAGGATTGCAGATTTCTGCCTTGAAATACCTGTTTCTTTGGGACATTCCGTCCTG
ATGATTTTTATTTTTGTTGGTTTTTATTTTTGGGGGGAATGACATGTTTGGGTCTTTTAT
ACATGAAAATTTGTTTGACAATAATCTCACAAAACATATTTTACATCTGAACAAAATGCC
TTTTTGTTTACCGTAGCGTATACATTTGTTTTGGGATTTTTGTGTGTTTGTTGGGAATTT
TGTTTTTAGCCAGGTCAGTATTGATGAGGCTGATCATTTGGCTCTTTTTTTCCTTCCAGA
AGAGTTGCATCAACAAAGTTAATTGTATTTATGTATGTAAATAGATTTTAAGCTTCATTA
TAAAATATTGTTAATGCCTATAACTTTTTTTCAATTTTTTTGTGTGTGTTTCTAAGGACT
TTTTCTTAGGTTTGCTAAATACTGTAGGGAAAAAAATGCTTCTTTCTACTTTGTTTATTT
TAGACTTTAAAATGAGCTACTTCTTATTCACTTTTGTAAACAGCTAATAGCATGGTTCCA
ATTTTTTTTAAGTTCACTTTTTTTGTTCTAGGGGAAATGAATGTGCAAAAAAAGAAAAAG
AACTGTTGGTTATTTGTGTTATTCTGGATGTATAAAAATCAATGGAAAAAAATAAACTTT
CAAATTGAAATGACGGTATAACACATCTACTGAAAAAGCAACGGGAAATGTGGTCCTATT
TAAGCCAGCCCCCACCTAGGGTCTATTTGTGTGGCAGTTATTGGGTTTGGTCACAAAACA
TCCTGAAAATTCGTGCGTGGGCTTCTTTCTCCCTGGTACAAACGTATGGAATGCTTCTTA
AAGGGGAACTGTCAAGCTGGTGTCTTCAGCCAGATGACATGAGAGAATATCCCAGAACCC
TCTCTCCAAGGTGTTTCTAGATAGCACAGGAGAGCAGGCACTGCACTGTCCACAGTCCAC
GGTACACAGTCGGGTGGGCCGCCTCCCCTCTCCTGGGAGCATTCGTCGTGCCCAGCCTGA
GCAGGGCAGCTGGACTGCTGCTGTTCAGGAGCCACCAGAGCCTTCCTCTCTTTGTACCAC
AGTTTCTTCTGTAAATCCAGTGTTACAATCAGTGTGAATGGCAAATAAACAGTTTGACAA
GTACATACACCATA

Protein Sequence

>861 : length: 480
MASDSIFESFPSYPQCFMRECILGMNPSRDVHDASTSRRFTPPSTALSPGKMSEALPLGA
PDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVA
LGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVF
TNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSP
HHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPAT
PISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPV
TSGIGIGMSAMGSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVG
GERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY