ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

857

Name

CAV1

Synonym

BSCL3|CGL3|LCCNS|MSTP085|PPH3|VIP21;caveolin 1, caveolae protein, 22kDa;CAV1;caveolin 1, caveolae protein, 22kDa

Definition

caveolin-1|cell growth-inhibiting protein 32

Position

7q31.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

ALK1 signaling events;PID Curated;200126

Pathway

Basigin interactions;PID Reactome;500308

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

ion channels and their functional role in vascular endothelium;PID BioCarta;100055

Pathway

NOSTRIN mediated eNOS trafficking;PID Reactome;500851

Pathway

PDGFR-alpha signaling pathway;PID Curated;200140

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

TNF receptor signaling pathway;PID Curated;200086

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

corticosteroids and cardioprotection;PID BioCarta;100156

Pathway

eNOS activation;PID Reactome;500849

Pathway

Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis;PID Reactome;500799

Pathway

Metabolism of nitric oxide;Reactome;REACT:12508

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Insulin Pathway;PID Curated;200012

Pathway

Canonical Wnt signaling pathway;PID Curated;200064

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

actions of nitric oxide in the heart;PID BioCarta;100094

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Viral myocarditis;KEGG PATHWAY;hsa05416

Pathway

Hemostasis;Reactome;REACT:604

Pathway

integrin signaling pathway;PID BioCarta;100123

Pathway

vegf hypoxia and angiogenesis;PID BioCarta;100006

Disease

Scleroderma;FunDO

Disease

Primary biliary cirrhosis;FunDO

Disease

Hypertension;FunDO

Disease

Electrocardiographic traits;NHGRI

Disease

Genetic disorders;KEGG DISEASE

Disease

Lipodystrophy, congenital generalized, type 3;OMIM

Disease

Systemic scleroderma;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

Bladder cancer;FunDO

Disease

Congenital generalized lipodystrophy;KEGG DISEASE;H00419

Disease

Pulmonary fibrosis;FunDO

Disease

prostate cancer;GAD

Disease

Other genetic disorders;KEGG DISEASE

Disease

Glaucoma (primary open-angle);NHGRI

Disease

Cancer;FunDO

Disease

PR interval;NHGRI

Disease

Oral cancer;FunDO

Disease

CANCER;GAD

Disease

Rabies;FunDO

Disease

blood pressure, arterial hypertension;GAD

External Links

Links to cell senescence gene database

857

Links to epithelial mesenchymal transition gene database

857

Links to ovarian cancer gene database

857

Links to endometrial cancer gene database

857

Links to iHOP

857

Sequence Information

Nucleotide Sequence

>857 : length: 3212
TAAAGCACAGCCCAGGGAAACCTCCTCACAGTTTTCATCCAGCCACGGGCCAGCATGTCT
GGGGGCAAATACGTAGACTCGGAGGTAGGCATCCGTGGGGGGGCGCCGGCTCGGGCGTGC
GGGGAGTGTCCGCTTCTGCTATCTGCCTCTCCAAATATCCCGACTGCTGCCCTGGCCCCA
GCCCTCTCTCCACTTCGGAGCACTCCTCTGGCGTTGGCACCGCTGAGGAATGGGCCTGGG
CGGGGAGGTGAAGAGAAGCCAGGAATGTTTTATGTTTTCCTAATGGAGAGGGGGCCTAGG
GAGCCCCTGAGCTAGGAGGACACGGAAAAGGGGATTGGGGTCCTGAGATTGGGTCTGTTG
GGCCCAGGACGCGTTTTCTGGATGGGTCTAGGATGCTCCCTTGTCGCGGGACCCCCGCGG
TCCGGCCCTGCCTGCTGGGGGTTCGAAGAGGTGGAGTGCAGGGTGGAGGTGTTATTTACC
CGAGTCCTGGGGACAGTCCCCGGGACTCTCCGCCAGGCGCCCAGACCGGCAGGTCCCGCA
GGCGGCGCGCGGTGTGTTTGCACTTTCCAAAGTTCTTGAACCATCTCAAGAACTCCTTCT
GCATCTTGGCGTCTGGCAGGGGTGTTCCGAGAGAGGTAGACCTCCCCTCCCCAAACTGCC
ACCATCACTTCCAACGCCCTCCACGCGCTGGAGCTCTGCCCGGGTGTGGAAACCTCGTCT
TCCAACACGTAGCTGCCCTTCAGCCACCCGCCCGCAGCCTGGGAGTGCCCTGAGGGTGGG
TCGGGGGAGCTGCGCAGGGACATCTCTACACCGTTCCCATCCGGGAACAGGGCAACATCT
ACAAGCCCAACAACAAGGCCATGGCAGACGAGCTGAGCGAGAAGCAAGTGTACGACGCGC
ACACCAAGGAGATCGACCTGGTCAACCGCGACCCTAAACACCTCAACGATGACGTGGTCA
AGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTT
GGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTG
CCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCC
TGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCA
GCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGA
AAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAAATGACATTTCAAGGAT
AGAAGTATACCTGATTTTTTTTCCTTTTAATTTTCCTGGTGCCAATTTCAAGTTCCAAGT
TGCTAATACAGCAACAATTTATGAATTGAATTATCTTGGTTGAAAATAAAAAGATCACTT
TCTCAGTTTTCATAAGTATTATGTCTCTTCTGAGCTATTTCATCTATTTTTGGCAGTCTG
AATTTTTAAAACCCATTTAAATTTTTTTCCTTACCTTTTTATTTGCATGTGGATCAACCA
TCGCTTTATTGGCTGAGATATGAACATATTGTTGAAAGGTAATTTGAGAGAAATATGAAG
AACTGAGGAGGAAAAAAAAAAAAAAGAAAAGAACCAACAACCTCAACTGCCTACTCCAAA
ATGTTGGTCATTTTATGTTAAGGGAAGAATTCCAGGGTATGGCCATGGAGTGTACAAGTA
TGTGGGCAGATTTTCAGCAAACTCTTTTCCCACTGTTTAAGGAGTTAGTGGATTACTGCC
ATTCACTTCATAATCCAGTAGGATCCAGTGATCCTTACAAGTTAGAAAACATAATCTTCT
GCCTTCTCATGATCCAACTAATGCCTTACTCTTCTTGAAATTTTAACCTATGATATTTTC
TGTGCCTGAATATTTGTTATGTAGATAACAAGACCTCAGTGCCTTCCTGTTTTTCACATT
TTCCTTTTCAAATAGGGTCTAACTCAGCAACTCGCTTTAGGTCAGCAGCCTCCCTGAAGA
CCAAAATTAGAATATCCATGACCTAGTTTTCCATGCGTGTTTCTGACTCTGAGCTACAGA
GTCTGGTGAAGCTCACTTCTGGGCTTCATCTGGCAACATCTTTATCCGTAGTGGGTATGG
TTGACACTAGCCCAATGAAATGAATTAAAGTGGACCAATAGGGCTGAGCTCTCTGTGGGC
TGGCAGTCCTGGAAGCCAGCTTTCCCTGCCTCTCATCAACTGAATGAGGTCAGCATGTCT
ATTCAGCTTCGTTTATTTTCAAGAATAATCACGCTTTCCTGAATCCAAACTAATCCATCA
CCGGGGTGGTTTAGTGGCTCAACATTGTGTTCCCATTTCAGCTGATCAGTGGGCCTCCAA
GGAGGGGCTGTAAAATGGAGGCCATTGTGTGAGCCTATCAGAGTTGCTGCAAACCTGACC
CCTGCTCAGTAAAGCACTTGCAACCGTCTGTTATGCTGTGACACATGGCCCCTCCCCCTG
CCAGGAGCTTTGGACCTAATCCAAGCATCCCTTTGCCCAGAAAGAAGATGGGGGAGGAGG
CAGTAATAAAAAGATTGAAGTATTTTGCTGGAATAAGTTCAAATTCTTCTGAACTCAAAC
TGAGGAATTTCACCTGTAAACCTGAGTCGTACAGAAAGCTGCCTGGTATATCCAAAAGCT
TTTTATTCCTCCTGCTCATATTGTGATTCTGCCTTTGGGGACTTTTCTTAAACCTTCAGT
TATGATTTTTTTTTCATACACTTATTGGAACTCTGCTTGATTTTTGCCTCTTCCAGTCTT
CCTGACACTTTAATTACCAACCTGTTACCTACTTTGACTTTTTGCATTTAAAACAGACAC
TGGCATGGATATAGTTTTACTTTTAAACTGTGTACATAACTGAAAATGTGCTATACTGCA
TACTTTTTAAATGTAAAGATATTTTTATCTTTATATGAAGAAAATCACTTAGGAAATGGC
TTTGTGATTCAATCTGTAAACTGTGTATTCCAAGACATGTCTGTTCTACATAGATGCTTA
GTCCCTCATGCAAATCAATTACTGGTCCAAAAGATTGCTGAAATTTTATATGCTTACTGA
TATATTTTACAATTTTTTATCATGCATGTCCTGTAAAGGTTACAAGCCTGCACAATAAAA
ATGTTTAACGGTTAAACAGTCAAAAAAAAAAA

Protein Sequence

>857 : length: 178
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI