ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8544

Name

PIR

Synonym

pirin (iron-binding nuclear protein);PIR;pirin (iron-binding nuclear protein)

Definition

pirin|probable quercetin 2,3-dioxygenase PIR|probable quercetinase

Position

Xp22.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

y branching of actin filaments;PID BioCarta;100254

External Links

Links to cell senescence gene database

8544

Links to epithelial mesenchymal transition gene database

8544

Links to ovarian cancer gene database

8544

Links to endometrial cancer gene database

8544

Links to iHOP

8544

Sequence Information

Nucleotide Sequence

>8544 : length: 1576
AGTTAAAAACAGATTTCCCACAAGACCGACCGGAGCGCCGATCAGAGCACCTGCCCGGGC
CACACATTTCCTCCTGGAGCACAGCAAGTGCCGCCTAAATTACCCGAGTGAGCATCTCTT
CCCGGCACGAGAGGCAGGGAGGCCAAAGGGCCGCCAAGCTGGCCTGGGAGAGGCGTAGGG
CGGAGCGAGAGTGGAGTGACATTCCCGAGGGCGGAGCCCCAGGGCCTCCGAGACCCGTAG
ACTCCCGCCTCCCGCCTCCTCTAGGCCGCCGGCCGCGAAGCGCTGAGTCACGGTGAGGCT
ACTGGACCCACACTCTCTTAACCTGCCCTCCCTGCACTCGCTCCCGGCGGCTCTTCGCGT
CACCCCCGCCGCTAAGGCTCCAGGTGCCGCTACCGCAGCGTGAGTACCTGGGGCTCCTGC
AGGGGTCCACTAGCCCTCCATCCTCTACAGCTCAGCATCAGAACACTCTCTTTTTAGACT
CCGATATGGGGTCCTCCAAGAAAGTTACTCTCTCAGTGCTCAGCCGGGAGCAGTCGGAAG
GGGTTGGAGCGAGGGTCCGGAGAAGCATTGGCAGACCCGAGTTAAAAAATCTGGATCCGT
TTTTACTGTTTGATGAATTTAAAGGAGGTAGACCAGGAGGATTTCCTGATCATCCACATC
GAGGTTTTGAAACAGTATCCTACCTCCTGGAAGGGGGCAGCATGGCCCATGAAGACTTCT
GTGGACACACTGGTAAAATGAACCCAGGAGATTTGCAGTGGATGACTGCGGGCCGGGGCA
TTCTGCACGCTGAGATGCCTTGCTCAGAGGAGCCAGCCCATGGCCTACAACTGTGGGTTA
ATTTGAGGAGCTCAGAGAAGATGGTGGAGCCTCAGTACCAGGAACTGAAAAGTGAAGAAA
TCCCTAAACCCAGTAAGGATGGTGTGACAGTTGCTGTCATTTCTGGAGAAGCCCTGGGAA
TAAAGTCCAAGGTTTACACTCGCACACCAACCTTATATTTGGACTTCAAATTGGACCCAG
GAGCCAAACATTCCCAACCTATCCCTAAAGGGTGGACAAGCTTCATTTACACGATATCTG
GAGATGTGTATATTGGGCCCGATGATGCACAACAAAAAATAGAACCTCATCACACAGCAG
TGCTTGGAGAAGGTGACAGTGTCCAGGTGGAGAACAAGGATCCCAAGAGAAGCCACTTTG
TCTTAATTGCTGGGGAGCCATTAAGAGAACCAGTTATCCAACATGGTCCATTTGTGATGA
ACACCAATGAAGAGATTTCTCAAGCTATTCTTGATTTCAGAAACGCAAAAAATGGGTTTG
AAAGGGCCAAAACCTGGAAATCAAAGATTGGGAACTAGTGGAAAGCGGAAGAGCAGGTCT
TGATGTGTCCTAGAATTTTGCCATTTCTGAGATTGAGCCATTGAAGGCATTCCATTTCTA
AAGCTTATTTAGCCGGTGCTTCTAAAGAATTCCACACTAACGTGATAACATGGTTTTTGT
AACAATAAATGTAGGATATTTCCTGGCACATGCAAATAAACCTAATCATTGTTTCTTTAA
AAAAAAAAAAAAAAAA

Protein Sequence

>8544 : length: 290
MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRG
FETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNL
RSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGA
KHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVL
IAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN