ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8543

Name

LMO4

Synonym

LIM domain only 4;LMO4;LIM domain only 4

Definition

LIM domain only protein 4|LIM domain transcription factor LMO4|LMO-4|breast tumor autoantigen

Position

1p22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

IL6-mediated signaling events;PID Curated;200124

Disease

response to TNF antagonist treatment;GAD

Disease

PHARMACOGENOMIC;GAD

Disease

Response to TNF antagonist treatment;NHGRI

External Links

Links to cell senescence gene database

8543

Links to epithelial mesenchymal transition gene database

8543

Links to ovarian cancer gene database

8543

Links to endometrial cancer gene database

8543

Links to iHOP

8543

Sequence Information

Nucleotide Sequence

>8543 : length: 5415
GCTCTGTCAGTAACACATGTGTAAGAGCCGCGGAGGGAGCGAGCGAGCCGGCTAGAGGCC
AGCGCCGCCGCCGCCGCCGCCTCCGAGCCGGGCAGCAACAGCCCCGGCAGCGGCGCAGGC
TCCAGCGCGCCGGGCCCGGCCGGCCGCAGCCCCCGACGCCTGGGTGCGCCTGCCTGCCGG
CCTCCGCACCGTCCGCCGCCGCTCCCGGGGCTGTTGTGTCTGCGACTGCTCCCGGCCGGA
GGTGCAGGGAGCTCAGCCGAGCCGCCGCTGCCATCCCGGAGCGAGCAAGCGAGCGAGCGC
GCGGGAGGGAGGAAGGCGGCGGCGGAGGAGGAGGAGGAGCGGGAGGAGCGCGGGCGGGGG
CGGGGGCCCCCGGGCGGGGGAATATACAAAGTGAAGCCACATTGCCAAACTTGCAGCAGC
GATTGCAGCAGTTGCTGCCGCTGCGCCGCGCCTGAAGCCGCGCCGCGCGGGCCGAGGGCT
CCTGCAGCTGCTCGCGCGCAGTCGGAGGCGGAGAAGGACGAAGACTGAGACTGACACTTC
TGCTCCCGGCCGCCCGGCACTTACGCGGGGGCCCCCCAACCCGCCCCAGAGCAACGCGAT
TTAAAAAAAAAAAAAAAGCCGCCCTTAGCCCCCTCCTCCCCTTTCCTGCTTCTGCGAGAA
CTCCCTCCCTCCCTCCAGCTCCGCCAGCCCAGGCGCCCCTTCCCTGGAAGCCGAGCGGCT
TCGCTCGCATTTCACCGCCGCCGCCTCTCGCAATATTGCAATATAGGGGAAAAGCAGACC
ATGGTGAATCCGGGCAGCAGCTCGCAGCCGCCCCCGGTGACGGCCGGCTCCCTCTCCTGG
AAGCGGTGCGCAGGCTGCGGGGGCAAGATTGCGGACCGCTTTCTGCTCTATGCCATGGAC
AGCTATTGGCACAGCCGGTGCCTCAAGTGCTCCTGCTGCCAGGCGCAGCTGGGCGACATC
GGCACGTCCTGTTACACCAAAAGTGGCATGATCCTTTGCAGAAATGACTACATTAGGTTA
TTTGGAAATAGCGGTGCTTGCAGCGCTTGCGGACAGTCGATTCCTGCGAGTGAACTCGTC
ATGAGGGCGCAAGGCAATGTGTATCATCTTAAGTGTTTTACATGCTCTACCTGCCGGAAT
CGCCTGGTCCCGGGAGATCGGTTTCACTACATCAATGGCAGTTTATTTTGTGAACATGAT
AGACCTACAGCTCTCATCAATGGCCATTTGAATTCACTTCAGAGCAATCCACTACTGCCA
GACCAGAAGGTCTGCTAAAAGGTCAGAGTAATGCAGAATGCGTGCCTTCATCTCAGATTT
GTTCATCACAGGTGGATCCCATGTGTCTTCAGTAGACAAGTCACCTTTGTAGCTAGCACC
AGTGCCAGCTCCATGCCATTGCACCTTCTTTAGTCTTGATTGCCCTTCCCGCATTTATTG
GTGTATTAAAATGACTGAATATGAACATTAAGGACTCCATGAACCTGGGCTAATGGGAGA
CTGTAGAGAAAATGAAAAAAGATCCACCAGAGGACATCTTGGGGAGGGGGAGGGAGCTGG
GGGGGAGGGAAATGACTAATGAAGCTAATTAAAAGAAGCATTCAAATCTGCTTTCTACCC
TCATTAACAATTAGCAGGGCACTGGCCAGAGTTTGTACCCTGTGTTTTACCTTAACAACA
TTCTATTTGCTCTTTGTATATTTAAGTGTTGTAAGGAAACGTGTTTCAATCAAAACTGAC
CATGAGATAAAGGAAAGAGATGTGGCTTTTGTGATATTCTATCACAAACACTTATTGTAT
CTCTGTAAAATACAATGTATGTATGCATGTAAGTGTTTTTGTCCTAATGTTGCTACTCCC
ATGGCAAAGAAAAAAAAAAGAATGAAAAAAAGAAAAAAATTTGGAAAAAAAAATCAGGCT
CATAGCAGCTACTGTGTAGAAAATTCCCCCTACTTCTAATTTGCTGAATGAAGAAAAAAA
AAAATCTTTTATTTGTGATATTTTCAGAGACATTTGCTCTAGTATGGTGTATTTAAATAA
TAAAAACTTAAAAGAAAAAATATTTAATGGTGTTTGGGTTTAAACACTGCTTTTTCTCTT
CTGTATTTTGAAGAAATTTAGTTTTTATTGTTGTTGAATAACAAGCTCACTTTAAATTTG
AAGGAGTTGAGGGAGGTGGAGTGTATATTTATTTAGCTCTGGGCCAGTAAGGTATTCTTC
AAATTACTTAACCACGCCATTATTGGCAGGGGTACAAAGTAGTTTCTAACAGGGTCCTTT
CTATAAGTCAAGAATATTCTGTTAACAGCATTTCGTTACACTTCTATATCACAGTAAGTC
TTTTGTGTTTATAAATACTTGAGTGTCCACTATTTTGTTTATTCTTTTTCTCAATAGCAA
ACAAAGCCTTGGGTATTGATGAAAAGTATGTATAAAAAAAAATACGGCACAACCATCCTG
TTCTCTTATTGAGTTTATAGCTTTTGAAGGAAGTCACAATTTCTAAGTCATACCTGTACA
TATTTTGAAGCTCACTTAGTTGTAGGGACCCAGAGCTCTTTTTTTATGGTGATCTTTGAT
TGGTGAAGTAGCCATTTCCTGGTGACCCTTAGGCTCGTGTGGTTGGCTGTAAGGTGTTTA
TTTTGTTTTGCTCCTACACTTCTTTACTGACTGCGTTTCCGTATGTATTTTGGGGGAAGA
TTCTGACTTCATTTAGTCTTAGTCTTGAGATACTGAGTTGCTGGTTGCAGGCAGCAGAGT
GTCCACCACAGTGCCTGCACTGCCCGCAGAGCTGCCCTCCGGAAAGCATGCAGTATAACA
GCTAGTGCTGGAAGGAGGAAAACCAAATAGGCCTGGAGGCTGAGGTTGTACTGCCAGCTT
CCTTAGATGTGAGCAAATTTCAACTACAACTTCCATCACAGGCTAATAAAACCAGGTGTG
TGAACGCTACTATTTTAAATTTTCTTTTTTAAGATGGCATTTTATTTTGTTCCAGAAAAG
CGCCTGATGTAGACCCTCCCTCTGAGAATAGCCGTGGAGCCATGTAGAGAGGTGTAGCTC
AGCACATCTCAACTACCAGTCAGCTTCCCTTTGAGAACTTCTGTGCTCACTTCCTGTTTT
CAGAGATTCCAGGGCAGGGGAAAAAAAAAATCAGTTGAACTTCAAACCTCCTAGAGGAGA
TTGTAAAGGCATAGAGTTGAGGTGAATAGTTTTGTTAGAACCTTATAAAAATAAAATGCA
AGAAAATAATATGAAGAAATCACATATATATGTTTGAATTAGATGTCTGTTTGAATTAGA
TCCTTGGGGAATTTCTTCAAACTAGTTCTGGTTCTTATATTTGTTTTTTTTCCTTTAAGG
AACTTTCTGAAGGAAGTTAGACTGCGATGGTAAAGGGGGAAATGGGTTAATGAGATTGCA
GGCATTTTCTATATTCTTTTTGGCATAAGCACTTATGTCCCTGATATGTACAAATTCAAA
GGAGGTGGTTAATAACTTTAGTAAATAATATATTGTCGCATTTAATGATGTGGAGGGCTA
AGGTCATTACGGACTTTAAATAAACTATTATATGGCTGGTTCCTCAAGCACTGCTGCGTA
TTTAATAATGAGCTTCTAAAAGCATTTCTTAAGTTGCAGACCTATAAGATTACAAATGTC
ACTCATGTTAGTATAATCCACATGCAAGTGATGAAGCCTTCTCTTTGATGTGCTAAATTG
GAGAAGGACTAATGGAGCTATGAATATACAATAGAACATATTTAAGTAGTAGTCTTGCTT
TAGGTAAAACACTTTCTTGAAACCAGAGGCATTTCAAACAATAAAACCCGGCTCTAATGG
GGATGCTCTGTGTGGATAGAAAGCTACTAAAAACACTCAGGTTTATTCTGATGTGAGCAG
CGATTGTGTGCAGTTCCTCCCCCAATCTCAACATTGCTTAGGAAAAAAAAAAATCTATGA
GTTTATTCCACCTTTCATCCATTGCATTTGTGATGTTATTAGTTAGCAAGATGGACACTG
TTCTTTAGAAAGGACTTATTTAATATTAACCACGTCATAGAGCAAGATGGCCCCCAGTCC
CTACAAGCAAGTGCAATTAAAAATAAAAGCAAATGTTACTGAGCCCTGCTGAACTCCTGA
TAAAAAAAATTATGTTTATGGTACATATAAATGTCTCAATCATGCAAATTGTCACTCTTG
TTAATGAAACAATTTTGTAAAAAGATAGTCCTCTAAAAGGGTTTAATGTTTTTTACCTAT
CTAACTGTCTAATTAGATTTACACATCCCGCAAGGCAGGGGAGCCTGAAGCTTTTCCAAA
CCAAATCGTTTGCCACTAGAAACTATTTTCAGCTCTTCATGATTTATTAGGAAATAGTTT
AACCCGGACTGTAGTGTCTTATAAAATACAAAACGAGAAAACTGACACACCAAAATGAAG
TCTGTGAAATTGTCATCCTCTTAATATTACCTGTATTTAAATTCTTTCTTTTGCCCTTAT
TAACACTGATATTTGAAACAACTAATCATCTAAAAGGAAGCTCTTAAAGGGCTTTAAATG
TCAATATAGTAAGATTCTAATGTGCACTACTATTTATATAAAATATTTCTTAGGGCCCAT
AAATCATATAATAAACAGTGAACCCAAGAGCTACATATGGAGTCTAGTGAAGAGTTCCCA
TGTAGCCTAACTAATTGTATTTAAATTGAGGAGATCCAAAAACCCCATCACCCTTCACCC
CAAAGACCCCTTCACCCTTCACCAGGGAATTCTATCCTGGGTGCTGTCCCACCTATGACC
CCTTCAAGAGGCCATTGGAAAAAGGCCATTTACAAGTTAATGTTACTTATAGCTTTGTTA
CTAAGACTCACCTATTGTTAGTGCAGCCAAGTCACAGAAGTGCTTATTGCAGTTAAATAG
CAATTTGTTTCCATGAAACTGCAATTAAAGTATTACTGAGCAGCCATTTTAGATTGGCAG
TGCTCTGAACGCATGTTAAACAGCCAGCTACTCCCACTTGCAGAGTCTGAGATCTGACTA
GCAGCAAAGTGTAGCACATTCGCCGATGCTGGGTACCTAGTTAAAGAGGCATTTGTAGCC
CTCTGCTCCCATCGTGAACATGCTGAGAGCAATGACAAGTCAGGGCTGATTTTTGGAAGG
TGAACTTGCAACTTACCTCAAGTGAATACTGTTTTCAGTTGTGCAAGAAGTGCTTTATGC
TAGTAGATATGTGCATGTTTCCTAGAGGGAATGTTTTCAAGTTCAGATTGATTCTGCTGA
GAATGGACGGCAACTCGGAGGCCTCAAGCCAATAATGTACTACAGGCCCTGACATGTTAC
AGCTGTGTAAACAGGGCCATTCTATTTCCTAAATCACAACTAATAAAGCAGAGGATGAAA
ATCAAAAAAAAAAAA

Protein Sequence

>8543 : length: 165
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDI
GTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRN
RLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC