ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8533

Name

COPS3

Synonym

CSN3|SGN3;COP9 signalosome subunit 3;COPS3;COP9 signalosome subunit 3

Definition

COP9 complex subunit 3|COP9 constitutive photomorphogenic homolog subunit 3|COP9 signalosome complex subunit 3|JAB1-containing signalosome subunit 3|signalosome subunit 3

Position

17p11.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

8533

Links to epithelial mesenchymal transition gene database

8533

Links to ovarian cancer gene database

8533

Links to endometrial cancer gene database

8533

Links to iHOP

8533

Sequence Information

Nucleotide Sequence

>8533 : length: 1865
GGAAGTGACGTCGCCGCTCGCGAGGACCTCAGGTGGATCGCCGCGGCCCCTCCTCCCAGA
GCGGCAGCCTTTTCCCGCGCGTGCTGCCTTCGCCGCTCGGGCCGCCCGGGGGAAAACATG
GCGTCTGCCCTGGAGCAGTTCGTGAACAGTGTCCGACAGCTCTCAGCTCAAGGGCAAATG
ACACAGCTTTGTGAACTGATCAACAAGAGTGGGGAACTCCTTGCGAAGAACTTATCCCAT
CTGGACACTGTGCTCGGGGCTCTGGATGTACAAGAACACTCCTTGGGCGTCCTTGCTGTT
TTGTTTGTGAAGTTTTCTATGCCCAGTGTTCCTGACTTCGAAACGCTATTCTCACAGGTT
CAGCTCTTCATCAGCACTTGTAATGGGGAGCACATTCGATATGCAACAGACACTTTTGCT
GGGCTTTGCCATCAGCTAACAAATGCACTTGTGGAAAGAAAACAGCCCCTGCGAGGAATT
GGCATCCTTAAGCAAGCCATAGACAAGATGCAGATGAATACAAACCAGCTGACCTCAATA
CATGCTGATCTCTGCCAGCTTTGTTTGCTAGCAAAATGCTTTAAGCCTGCCCTTCCATAT
CTTGACGTGGATATGATGGATATCTGTAAAGAGAATGGAGCCTATGATGCAAAACACTTT
TTATGTTACTATTATTATGGAGGGATGATCTATACTGGGCTGAAGAACTTTGAAAGAGCT
CTCTACTTTTATGAACAGGCTATAACTACTCCTGCCATGGCGGTCAGTCATATCATGTTG
GAATCATATAAAAAGTATATTTTAGTGTCTTTGATATTACTTGGCAAAGTACAACAGCTA
CCAAAATATACATCTCAAATTGTGGGTAGATTCATTAAGCCTCTTAGCAATGCATACCAC
GAGTTAGCACAAGTGTATTCAACCAACAACCCCTCAGAACTCCGAAACCTGGTGAATAAG
CACAGTGAAACCTTCACTCGCGATAACAACATGGGGCTGGTGAAGCAATGCTTGTCATCT
CTTTATAAGAAGAATATTCAGAGGCTAACAAAGACCTTTTTAACTCTATCATTACAAGAT
ATGGCAAGTCGTGTGCAGTTGTCTGGACCTCAGGAGGCAGAGAAATACGTTCTGCACATG
ATAGAAGATGGTGAGATTTTTGCAAGTATTAACCAGAAGGACGGTATGGTCAGTTTCCAT
GATAACCCTGAAAAATATAATAACCCAGCCATGCTTCATAACATTGATCAGGAGATGCTG
AAGTGCATTGAGCTGGATGAGCGGCTGAAAGCCATGGACCAGGAGATCACAGTGAACCCT
CAGTTTGTACAAAAGAGTATGGGCTCACAAGAAGATGATTCAGGAAACAAACCATCCAGT
TATTCTTGAAACTAACATCCATCCTGAGCTAAACAAGAGAAACTACCATCTTGGCCAGTG
ACAAGTGTTCGGAGGGCAGCAGAGAGGACCAAGCCTGTGTCACCTGGAGACTAAGAAATT
AAGTTTTGTTTTGACATCTTCAGTCCTGTGTGCTTTCAGAAAACCATTTTCTCTGCAAAG
AAAGGAAACAGATTTGCAAACTTTAAAGTCTGTCGTGGATTTATTTATCCTCAGATTATT
GTTACTGCATTAAATCTACCTTTTTGTTTTAAGTTGCTTGAACATTAATGTGTCTTCTGT
ATCACTTTTTTCTCCTCTGAAGTTTTTAATAAGCACATTCATTGTGAACAGAAATAGCTG
GATTTTAGGAATTTTTGGAAGATTTGGATCTGAAAGGTTTTTATTTATTGACAAATTTGT
ATCTACAAAAAAATCTAAAAGTTGTAATCATTGTCTTCAGAAAATAAAAGAAAAGAAAGG
CCAAA

Protein Sequence

>8533 : length: 423
MASALEQFVNSVRQLSAQGQMTQLCELINKSGELLAKNLSHLDTVLGALDVQEHSLGVLA
VLFVKFSMPSVPDFETLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRG
IGILKQAIDKMQMNTNQLTSIHADLCQLCLLAKCFKPALPYLDVDMMDICKENGAYDAKH
FLCYYYYGGMIYTGLKNFERALYFYEQAITTPAMAVSHIMLESYKKYILVSLILLGKVQQ
LPKYTSQIVGRFIKPLSNAYHELAQVYSTNNPSELRNLVNKHSETFTRDNNMGLVKQCLS
SLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSF
HDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPS
SYS