ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

84939

Name

MUM1

Synonym

EXPAND1|HSPC211|MUM-1;melanoma associated antigen (mutated) 1;MUM1;melanoma associated antigen (mutated) 1

Definition

PWWP domain-containing protein MUM1|melanoma ubiquitous mutated protein|mutated melanoma-associated antigen 1|protein expandere

Position

19p13.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

84939

Links to epithelial mesenchymal transition gene database

84939

Links to ovarian cancer gene database

84939

Links to endometrial cancer gene database

84939

Links to iHOP

84939

Sequence Information

Nucleotide Sequence

>84939 : length: 4311
GGCGGCGGCGGCGGCGGTGGCGGAGGCGGTGAGCGCGGGCGGCGCGGACGGCAGCGGTTG
GCGGGCGGGTCCTCCGCTGTTGCGGCCGCTGCGGCCTCCTTGCCCGGGCTTGGGGCGCCG
CGCTGGGGAAAGCCGGGGGCCCGGACACATTGGCGTGAGACCTGGGAGTACGTTGTGCCA
AATCATTGCCACTTGCCACATGAGTGTAAATGATGGCGGATGCCAAGTATGTCCTCTGCC
GATGGGAAAAGCGATTATGGCCTGCGAAGGTTTTGGCCCGAACCGCGACTTCAACAAAAA
ATAAGAGAAGAAAGGAATATTTTCTAGCTGTGCAAATCCTCTCTCTAGAGGAAAAAATTA
AGGTGAAAAGCACTGAAGTTGAGATCCTAGAGAAGTCTCAAATTGAAGCCATTGCTTCCT
CGTTAGGGAACGCGAATCCCCTGAGCTGAAGGAGAAGGAAAAATGGATCCGCTTTCTTAA
ACCTTTCCAGAATTTGCCCCTAGAACCACTCCTATTCTTGACGCCCAGAATGGTCAGTGC
CTCACAGAATGAGGTTCCTGCGGCACCCCTGGAAGAACTGGCCTACAGACGGTCGCTTCG
CGTGGCTCTGGACGTTCTGAGCGAGGGCTCGATTTGGAGTCAAGAAAGCTCTGCAGGGAC
AGGTAGAGCTGACCGGTCTCTGCGAGGGAAGCCCATGGAGCATGTCTCCTCGCCCTGTGA
TTCGAACTCCTCATCTCTTCCCCGCGGAGACGTGTTGGGCAGTTCCAGACCTCACAGGAG
GAGGCCATGTGTGCAACAAAGCCTGTCAAGTTCGTTCACTTGTGAAAAGGACCCCGAGTG
CAAAGTGGACCACAAGAAGGGGCTCAGGAAAAGTGAAAACCCAAGAGGCCCGTTGGTCCT
CCCAGCTGGAGGTGGTGCCCAAGATGAGAGTGGGTCCAGAATCCACCACAAAAATTGGAC
TCTTGCAAGTAAGAGGGGAGGAAACTCAGCGCAGAAGGCTAGCTTGTGCCTGAATGGATC
TTCCCTTTCAGAGGACGACACGGAGAGAGACATGGGGAGCAAAGGAGGCAGCTGGGCAGC
CCCGTCCTTGCCCTCCGGGGTCAGGGAGGACGATCCCTGTGCCAACGCTGAGGGACACGA
CCCCGGTCTGCCGTTGGGCAGCCTCACTGCGCCCCCAGCCCCTGAGCCCTCGGCCTGCTC
AGAGCCTGGAGAATGCCCTGCGAAAAAGAGGCCGCGCCTGGATGGCAGCCAAAGGCCGCC
TGCCGTGCAGCTGGAGCCCATGGCAGCAGGGGCCGCACCATCCCCCGGGCCGGGGCCAGG
GCCCAGAGAGTCTGTGACCCCGCGCAGCACCGCCAGGCTGGGCCCGCCTCCCTCCCACGC
CTCTGCGGATGCAACCAGATGTCTTCCTTGCCCGGATTCCCAGAAGCTGGAGAAAGAGTG
CCAGTCTTCCGAAGAGTCCATGGGGTCTAATTCCATGCGTTCTATCCTGGAGGAAGACGA
GGAAGACGAGGAGCCACCAAGAGTCCTTTTATACCACGAACCACGTTCGTTTGAAGTAGG
AATGCTAGTCTGGCATAAACATAAAAAATACCCCTTCTGGCCAGCAGTGGTCAAAAGCGT
CAGGCAGAGAGATAAGAAAGCAAGTGTGCTATACATCGAAGGACACATGAACCCGAAAAT
GAAAGGTTTCACAGTGTCTCTTAAAAGTTTAAAGCACTTTGATTGTAAAGAGAAACAGAC
GCTTCTGAATCAAGCCAGGGAGGACTTCAACCAGGACATCGGCTGGTGTGTCTCCCTCAT
CACCGACTACAGGGTCCGGTTAGGCTGCGGGTCTTTTGCTGGCTCTTTCCTGGAATATTA
CGCGGCTGATATAAGCTATCCTGTCCGAAAATCCATCCAGCAGGACGTCTTGGGGACCAA
GCTTCCTCAACTGAGCAAGGGGAGCCCCGAGGAGCCCGTGGTGGGGTGCCCCCTGGGGCA
GAGGCAGCCCTGCCGGAAAATGCTCCCCGACCGCTCGCGGGCCGCCCGGGACCGGGCCAA
CCAGAAGCTGGTGGAGTACATTGTGAAGGCCAAGGGCGCGGAGAGCCACCTGCGGGCCAT
CCTAAAGAGCAGGAAGCCATCTCGCTGGCTGCAGACCTTCCTGAGCTCCAGCCAGTACGT
GACCTGTGTGGAGACCTACCTGGAGGATGAGGGGCAGCTGGACCTGGTGGTGAAGTACCT
GCAGGGCGTCTACCAGGAGGTGGGGGCCAAGGTGCTCCAGCGCACCAACGGCGACCGGAT
CCGGTTCATTCTGGACGTGCTTCTGCCCGAGGCCATCATCTGTGCGATCTCTGCGGTGGA
CGAGGTGGACTACAAGACGGCTGAGGAGAAGTACATCAAGGGGCCTTCGCTGAGCTACCG
GGAAAAAGAAATATTTGACAACCAGCTCCTTGAAGAGCGGAACCGGCGCCGTCGGTGAGG
GAGCAGCCGGCTGTGCTGTCAGCGGGGCCTGGCGGTGGAAGCGCCTCCAGTGTGCATGAG
CGTGTCTGAAGATGGGGGGCTCAGGGGGCACGTTTGCGTTTGGACCTGTCTGTGCGTTCT
CCTGCGTGGCAGTCCTGATTTCCATGCTTCTGGAGAATCCATTTCGTTAACACTGAAAGC
CAGTTCTCTTTTCCTGGCAGTTTTTTTCATTTTATTTTTGGCATTTTTTACAAGATACCG
TTCGGGAAAGGCTTTTGAAAGGACGGAAGCGTATTCACTGTGCGCCAGTACTCCTGGCTG
TGCTGTGGTTTCTCCCGACGTGCACATCGATCTCGTATGTGTGGCATCTGATATTAAACG
GGAGGTTTTAAGAAGCGTCTGCCGTGATCATGGAGCTTCGGAAGCGGGAATGGTTCTTCC
GGGTTTGCTGTTTTGTCTGTTTCCCCCTTGTGTGGTTTCCGCCTGCGACAGTTCCAGAAT
TTGCTCTCCCACTCAGTGTGCTCTGCAGCTGTGAGGAAACAGCCTTCGTTAGAGGCGGGA
GCAGAGACGAGCCGCTGCTCTGTGTCGTGTTTGCTGTGGCCGCAGGGAGAGGAGCAGGAC
ACGCACCTTTCCAGGGGCCTCTGTGTCCCGCACTGTGTGTGAGTGGACCGCAGCGCGCAG
CCACATGCCCTGGCTGCCATGGGCCAGACCGCCTCCACCTCCCCCGCCCGCCTGGCCTGT
CCTGAGTGCATTTCCCTGCACTGTGTCGTCACTGCACAGCCAGTCACCGCGGTCTCAGTC
ATCGGCGCGGATGGCTATGCTGGGGTCCCAGGGTGGCCGCAGCAGTCAGGGTCACTGTGG
GAGCCCTGGGGTGGAGTGACAAACCGCATTGTCCTGTGCCCGCCATGGCAGAAGCGCAGC
CTTTGTATGGAGGCCCAACCGCGCTCCCGTCTGGAGAAGCGGCTTCCGGGGTGTGGCTGC
CGGGTCGGCTCTGGTCCACAGCACGGTGCCGGGGCTGCAGGTTGTTGAGGGCTGTGACTC
CGTGGGGCTCAGCCAGGCTCCAGCAGGGTCAGACGTGCTGTTAAGAGCAAAGCCACAGAC
GATGACTTGTCCATTCTCAGTGGATGCTCCAGGCTGTGCCTACACAGCAGTGCTGGTGAC
ATGTCCAGGGTTCCAGGGCCCGGTGGCCTGGGAGCTGCTTTCTCCCCACTGGCTGGGCTG
CATCTGGCCCTGGCTGGAGGCCTTGCTTTGAGGGGCTGTGACCCTCTTCCCCCAGGCCCT
CCCCAGCCGACGACAGCCACCGGAGAGGAGATCGGAACACGATTGTCTCAGATGCAGGGC
GCTGTGCGGGACGAAGCCGCAAGGACTCTCGTATCGGGCCCTTGGGACTCGGGAGGTGCC
AGAGGCGGCGGCTGCTCTGGACCTCGGTGTTCACTGACCTTTGTTTCACTTGCCTCTGCT
CGACTCCGAGAGCAGGAAACCCGGCCGTGGCCTGGCAGCTCCGCCTCCCATGCCCGCACG
CTGGGGTCTGTCTTGTCTGGAGCAGTGGGGCACACCCCGGAGGAGGCGGGGGTCAGGGCT
GTCGGCCTTGGCCCCCTGCTGGTCGCTGTTTCGGGGACTCGGGGCGGCCAGTACCACCGC
CTGAGGCGGGGCTCAGCAGCGTTGCATGTACGGGCCTCGTACTGCCTCATGGAAAATCCT
CCGGAGCCGCCCTCCATTGTGGGTTCCTGAGAGTAGGACACATTGCCATGGTTTTGTGGG
AATCACGCGCCCCTGATGGAACTTTTCTGCTGTTGTGAAGTACTTTTATCCATTTGCTTC
TCTGCTGACCTTGCCAAGTTGTTCGAGGTGGAATTAAACACCTCCCAGACC

Protein Sequence

>84939 : length: 745
MMADAKYVLCRWEKRLWPAKVLARTATSTKNKRRKEYFLAVQILSLEEKIKVKSTEVEIL
EKSQIEAIASSLASQNEVPAAPLEELAYRRSLRVALDVLSEGSIWSQESSAGTGRADRSL
RGKPMEHVSSPCDSNSSSLPRGDVLGSSRPHRRRPCVQQSLSSSFTCEKDPECKVDHKKG
LRKSENPRGPLVLPAGGGAQDESGSRIHHKNWTLASKRGGNSAQKASLCLNGSSLSEDDT
ERDMGSKGGSWAAPSLPSGVREDDPCANAEGHDPGLPLGSLTAPPAPEPSACSEPGECPA
KKRPRLDGSQRPPAVQLEPMAAGAAPSPGPGPGPRESVTPRSTARLGPPPSHASADATRC
LPCPDSQKLEKECQSSEESMGSNSMRSILEEDEEDEEPPRVLLYHEPRSFEVGMLVWHKH
KKYPFWPAVVKSVRQRDKKASVLYIEGHMNPKMKGFTVSLKSLKHFDCKEKQTLLNQARE
DFNQDIGWCVSLITDYRVRLGCGSFAGSFLEYYAADISYPVRKSIQQDVLGTKLPQLSKG
SPEEPVVGCPLGQRQPCRKMLPDRSRAARDRANQKLVEYIVKAKGAESHLRAILKSRKPS
RWLQTFLSSSQYVTCVETYLEDEGQLDLVVKYLQGVYQEVGAKVLQRTNGDRIRFILDVL
LPEAIICAISAVDEVDYKTAEEKYIKGPSLSYRECWPSWLTKTGKAFGYRNWVFSCWIFM
VPPSCLPEKEIFDNQLLEERNRRRR