ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8493

Name

PPM1D

Synonym

PP2C-DELTA|WIP1;protein phosphatase, Mg2+/Mn2+ dependent, 1D;PPM1D;protein phosphatase, Mg2+/Mn2+ dependent, 1D

Definition

protein phosphatase 1D|protein phosphatase 1D magnesium-dependent, delta isoform|protein phosphatase 2C delta isoform|protein phosphatase Wip1|wild-type p53-induced phosphatase 1

Position

17q23.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

p53 pathway;PANTHER;P00059

Pathway

p53 pathway;PID Curated;200175

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Disease

Breast cancer;OMIM

External Links

Links to cell senescence gene database

8493

Links to epithelial mesenchymal transition gene database

8493

Links to ovarian cancer gene database

8493

Links to endometrial cancer gene database

8493

Links to iHOP

8493

Sequence Information

Nucleotide Sequence

>8493 : length: 4790
GGGGAAGCGCAGTGCGCAGGCGCAACTGCCTGGCTCTGCTCGCTCCGGCGCTCCGGCCCA
GCTCTCGCGGACAAGTCCAGACATCGCGCGCCCCCCCTTCTCCGGGTCCGCCCCCTCCCC
CTTCTCGGCGTCGTCGAAGATAAACAATAGTTGGCCGGCGAGCGCCTAGTGTGTCTCCCG
CCGCCGGATTCGGCGGGCTGCGTGGGACCGGCGGGATCCCGGCCAGCCGGCCATGGCGGG
GCTGTACTCGCTGGGAGTGAGCGTCTTCTCCGACCAGGGCGGGAGGAAGTACATGGAGGA
CGTTACTCAAATCGTTGTGGAGCCCGAACCGACGGCTGAAGAAAAGCCCTCGCCGCGGCG
GTCGCTGTCTCAGCCGTTGCCTCCGCGGCCGTCGCCGGCCGCCCTTCCCGGCGGCGAAGT
CTCGGGGAAAGGCCCAGCGGTGGCAGCCCGAGAGGCTCGCGACCCTCTCCCGGACGCCGG
GGCCTCGCCGGCACCTAGCCGCTGCTGCCGCCGCCGTTCCTCCGTGGCCTTTTTCGCCGT
GTGCGACGGGCACGGCGGGCGGGAGGCGGCACAGTTTGCCCGGGAGCACTTGTGGGGTTT
CATCAAGAAGCAGAAGGGTTTCACCTCGTCCGAGCCGGCTAAGGTTTGCGCTGCCATCCG
CAAAGGCTTTCTCGCTTGTCACCTTGCCATGTGGAAGAAACTGGCGGAATGGCCAAAGAC
TATGACGGGTCTTCCTAGCACATCAGGGACAACTGCCAGTGTGGTCATCATTCGGGGCAT
GAAGATGTATGTAGCTCACGTAGGTGACTCAGGGGTGGTTCTTGGAATTCAGGATGACCC
GAAGGATGACTTTGTCAGAGCTGTGGAGGTGACACAGGACCATAAGCCAGAACTTCCCAA
GGAAAGAGAACGAATCGAAGGACTTGGTGGGAGTGTAATGAACAAGTCTGGGGTGAATCG
TGTAGTTTGGAAACGACCTCGACTCACTCACAATGGACCTGTTAGAAGGAGCACAGTTAT
TGACCAGATTCCTTTTCTGGCAGTAGCAAGAGCACTTGGTGATTTGTGGAGCTATGATTT
CTTCAGTGGTGAATTTGTGGTGTCACCTGAACCAGACACAAGTGTCCACACTCTTGACCC
TCAGAAGCACAAGTATATTATATTGGGGAGTGATGGACTTTGGAATATGATTCCACCACA
AGATGCCATCTCAATGTGCCAGGACCAAGAGGAGAAAAAATACCTGATGGGTGAGCATGG
ACAATCTTGTGCCAAAATGCTTGTGAATCGAGCATTGGGCCGCTGGAGGCAGCGTATGCT
CCGAGCAGATAACACTAGTGCCATAGTAATCTGCATCTCTCCAGAAGTGGACAATCAGGG
AAACTTTACCAATGAAGATGAGTTATACCTGAACCTGACTGACAGCCCTTCCTATAATAG
TCAAGAAACCTGTGTGATGACTCCTTCCCCATGTTCTACACCACCAGTCAAGTCACTGGA
GGAGGATCCATGGCCAAGGGTGAATTCTAAGGACCATATACCTGCCCTGGTTCGTAGCAA
TGCCTTCTCAGAGAATTTTTTAGAGGTTTCAGCTGAGATAGCTCGAGAGAATGTCCAAGG
TGTAGTCATACCCTCAAAAGATCCAGAACCACTTGAAGAAAATTGCGCTAAAGCCCTGAC
TTTAAGGATACATGATTCTTTGAATAATAGCCTTCCAATTGGCCTTGTGCCTACTAATTC
AACAAACACTGTCATGGACCAAAAAAATTTGAAGATGTCAACTCCTGGCCAAATGAAAGC
CCAAGAAATTGAAAGAACCCCTCCAACAAACTTTAAAAGGACATTAGAAGAGTCCAATTC
TGGCCCCCTGATGAAGAAGCATAGACGAAATGGCTTAAGTCGAAGTAGTGGTGCTCAGCC
TGCAAGTCTCCCCACAACCTCACAGCGAAAGAACTCTGTTAAACTCACCATGCGACGCAG
ACTTAGGGGCCAGAAGAAAATTGGAAATCCTTTACTTCATCAACACAGGAAAACTGTTTG
TGTTTGCTGAAATGCATCTGGGAAATGAGGTTTTTCCAAACTTAGGATATAAGAGGGCTT
TTTAAATTTGGTGCCGATGTTGAACTTTTTTTAAGGGGAGAAAATTAAAAGAAATATACA
GTTTGACTTTTTGGAATTCAGCAGTTTTATCCTGGCCTTGTACTTGCTTGTATTGTAAAT
GTGGATTTTGTAGATGTTAGGGTATAAGTTGCTGTAAAATTTGTGTAAATTTGTATCCAC
ACAAATTCAGTCTCTGAATACACAGTATTCAGAGTCTCTGATACACAGTAATTGTGACAA
TAGGGCTAAATGTTTAAAGAAATCAAAAGAATCTATTAGATTTTAGAAAAACATTTAAAC
TTTTTAAAATACTTATTAAAAAATTTGTATAAGCCACTTGTCTTGAAAACTGTGCAACTT
TTTAAAGTAAATTATTAAGCAGACTGGAAAAGTGATGTATTTTCATAGTGACCTGTGTTT
CACTTAATGTTTCTTAGAGCCAAGTGTCTTTTAAACATTATTTTTTATTTCTGATTTCAT
AATTCAGAACTAAATTTTTCATAGAAGTGTTGAGCCATGCTACAGTTAGTCTTGTCCCAA
TTAAAATACTATGCAGTATCTCTTACATCAGTAGCATTTTTCTAAAACCTTAGTCATCAG
ATATGCTTACTAAATCTTCAGCATAGAAGGAAGTGTGTTTGCCTAAAACAATCTAAAACA
ATTCCCTTCTTTTTCATCCCAGACCAATGGCATTATTAGGTCTTAAAGTAGTTACTCCCT
TCTCGTGTTTGCTTAAAATATGTGAAGTTTTCCTTGCTATTTCAATAACAGATGGTGCTG
CTAATTCCCAACATTTCTTAAATTATTTTATATCATACAGTTTTCATTGATTATATGGGT
ATATATTCATCTAATAAATCAGTGAACTGTTCCTCATGTTGCTGAATTTGTAGTTGTTGG
TTTATTTTAATGGTATGTACAAGTTGAGTATCCCTTATCCAAAATGCTTGGGACCAGAAG
TGTTTCAGATTTTTTAAAATTTTGGAATATTTGCTTTATACTGAGCTTTTGAGTGTTCCC
AATCTGAAATTCAAAATGCTCTAATGAGCATTTCCTTTGAGCATCATGCCTGCTCTGAAA
AAGTTTCTGATTCTGGAGCATTTTGGATTTTGGATTTTCAGATTAGGGATGCTTAACCTG
GATTAACATTCTGTTGTGCCATGATCATGCTTTACAGTGAGTGTATTTTATTTATTTATT
ATTTTGTTTGTTTGTTTGAGATGGAGTCTCACTCTGTCATCCAGGCTAGAGTGCAGTGGC
GTGATCTCGGCTGACTGCAACCTCTGCCTCCCGGGTTCAAGTGATTCTCCTGCCTCAATC
TCTCTCCCCAGAAGCTGGGATTACAGGTGTGTGCCACCACACCCGGCTAATTTTTTTTTT
TTTTTTTGAGATGGAGTCTAGCTCTGTCATCCAGGCTGGAGTGCAGTGGTGTGATCTCGG
CTCCCTGCAACCTCTGCCTTCTGGGTTCCTGCGATTCTCCTGCCTCAGCCTCCTGAGTAG
CTGAGATTACAGGCACGCGCCACTGTGCCCAGCCAATTTTTGTATTTTTAGTAGAGATGG
GGTTTCACATGTCAGTCATGCTGGTCTTGATCTCCTGACCTCGTGATCCACCCGCCTCGA
CCTCCCAAAGTACTGGGATTACAGGCGTGAGCCACCGCATCCGGCCTGAGTTTTATGCTT
TCAATGTATTTCTTACATTTCAGTTCAAGTGATTTTCATGTCTCAGCCTCCTGAGTAGCT
GGAACTACAGGTGCGTGCCACCATGCCTGGCTAAGTTTTGTATTTTTAGTAGAGATGGGT
TTTCATCATGTTGGCCAAGATGGTCTTGATCTCTTGACCTCATGATCCACCAGCCTAGGC
CTCCCAAAGTGCTGGGATTACAGGTGTGAGCCACCGTGCCCAGCCAACTATGCCATTATT
TAACCATGTCCACACATTCTGGTTATTTTCAATATTTTGCAGAAGATAATTCTTGATCGG
TGTGTCTTATGCCACAAGGATTAAAATATGTATTCATTGCTACAAAACAATATCTCGAAA
TTTAGCAGTTTAAAACAACAAATATTATCTCCAGTTTCTGAGCCTCAGAAATCTGAGAGT
GGTTTAGCTGGGTGATAGTCTCGTGGTTTTGGTCAAGCTACCAACCAGGGCTACAATCTT
TCGAAGGTGTCATTGGGGCTAGAAGATCTGCTTCCCGCAAGACTCACAGCTGTTGGCAGG
AGACCTCAGTTTGTTGCCACATGTTCCCCTCCAGAGGGCCTCTCACAACATGGCAGTTAT
TTGTCCCCAGAGCAAGCAACACCGGAGGGCAAGGAAGAAGCCATGATGTTTTTTGTAACC
TAGCCTCTGAAAGTGTCATACCAATTCTGTATTTTGTTGGTCACACAGACCAAGTCAACT
ACAACGTGGGAGACTCCTACACAAGGCATGAATTCTAGGAGGTGGGCATTTTTAAGTGTC
ATCTGGAAGGAGGCTGTCACAACCTGGAAGTTAAAAGCATTGATATTCTGAAATACAGCG
TGTATAACATTGTTTTAGTAGGGTGTGCAATAGTTATGTTTTGGTAATAGCATTAATGAA
CAATGTTATTTTCATCTTCCAGACATCTGGAAGATTGCTCTAGTGGAGTAAAACATCTTA
ATGTATTTTGTCCCTAAATAAACTATCTCACTAACAAAAAAAAAAAAAAA

Protein Sequence

>8493 : length: 605
MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPG
GEVSGKGPAVAAREARDPLPDAGASPAPSRCCRRRSSVAFFAVCDGHGGREAAQFAREHL
WGFIKKQKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVII
RGMKMYVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSG
VNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHT
LDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQ
RMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVK
SLEEDPWPRVNSKDHIPALVRSNAFSENFLEVSAEIARENVQGVVIPSKDPEPLEENCAK
ALTLRIHDSLNNSLPIGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEE
SNSGPLMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRK
TVCVC