ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

84864

Name

MINA

Synonym

MDIG|MINA53|NO52|ROX;MYC induced nuclear antigen;MINA;MYC induced nuclear antigen

Definition

60S ribosomal protein L27a histidine hydroxylase|bifunctional lysine-specific demethylase and histidyl-hydroxylase MINA|histone lysine demethylase MINA|mineral dust induced gene protein|mineral dust-induced gene protein|myc-induced nuclear antigen, 53 kDa

Position

3q11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

External Links

Links to cell senescence gene database

84864

Links to epithelial mesenchymal transition gene database

84864

Links to ovarian cancer gene database

84864

Links to endometrial cancer gene database

84864

Links to iHOP

84864

Sequence Information

Nucleotide Sequence

>84864 : length: 5342
ACGCTGCCCCGCCTCCAGCCGCTGCGCCGCAACGCAGTGGGCTCGCGGCCGCGAGCAACA
GGCCGTGCCGGGTGAGTGGGGCGCTCTCGTGGGCATCCCAGCGCCGGGGCAGGCCGGGTA
GTGCCCGATCCCGCGGGGCGCGCGCTGCTGCTTTAGGCACCCGGGCTCGGGTGCGGGTCT
GGGAGACCTGTCGGTCGGCGAGAAGCCTCGGTGGCCGGCGCTGTGGTTGCGGGACCTGGG
ACGCGCTCCCAGGCGTCCCACCTCCCCGGAGACTGGGGCAGGGTGGGTGGGGCCCGGATC
TAGGGGTAGGGTCGCGGAAGCCTTGGTTACAGAGAGTCGCACACGTGGCCTGCTAATGGT
CGCGACACCGGTGACGAGCGCACGGAAAGTTTGGAGGCTTAGCAAGGAGGGTGGTGCCGG
CCTCCGCCCGGTGGTGGCAGAACTGCCTGTGCGAGCACGGCTTCCACGTGGGCTGCGCCG
CCGGGCGTCATGTCGGGCCTAAGAGACACGCTCTACAGCTGTGAAATCTGAAGTTCAGGT
TTGCATTTCCTTACTGCTTTGTCTTGAAGACAGAACGATGCCAAAGAAAGCAAAGCCTAC
AGGGAGTGGGAAGGAAGAGGGGCCGGCTCCCTGTAAGCAGATGAAGTTAGAAGCAGCTGG
GGGGCCTTCAGCTTTAAACTTTGACAGTCCCAGTAGTCTCTTTGAAAGTTTAATCTCGCC
CATCAAGACAGAGACTTTTTTCAAGGAATTCTGGGAGCAGAAGCCCCTTCTCATTCAGAG
AGATGACCCTGCACTGGCCACATACTATGGGTCCCTGTTCAAGCTAACAGATCTGAAGAG
TCTGTGCAGCCGGGGGATGTACTATGGAAGAGATGTGAATGTCTGCCGGTGTGTCAATGG
GAAGAAGAAGGTTTTAAATAAAGATGGCAAAGCACACTTTCTTCAGCTGAGAAAAGATTT
TGATCAGAAAAGGGCAACGATTCAGTTTCACCAACCTCAGAGATTTAAGGATGAGCTTTG
GAGGATCCAGGAGAAGCTGGAATGTTACTTTGGCTCCTTGGTTGGCTCGAATGTGTACAT
AACTCCCGCAGGATCTCAGGGCCTGCCGCCCCATTATGATGATGTCGAGGTTTTCATCCT
GCAGCTGGAGGGAGAGAAACACTGGCGCCTCTACCACCCCACTGTGCCCCTGGCACGAGA
GTACAGCGTGGAGGCCGAGGAAAGGATCGGCAGGCCGGTGCATGAGTTTATGCTGAAGCC
GGGTGATTTGTTGTACTTTCCCAGAGGAACCATTCATCAAGCGGACACTCCTGCGGGGCT
GGCCCACTCTACTCACGTGACCATCAGCACCTACCAGAACAATTCATGGGGAGATTTCCT
TTTGGATACCATCTCGGGGCTTGTATTTGATACTGCAAAGGAAGACGTGGAGTTACGGAC
CGGCATACCCCGGCAGCTGCTCCTGCAGGTGGAATCCACAACTGTTGCTACAAGACGATT
AAGTGGCTTCCTGAGGACACTTGCAGACCGGCTGGAGGGCACCAAAGAACTGCTTTCCTC
AGACATGAAGAAGGATTTTATTATGCACAGACTCCCCCCTTACTCTGCGGGAGATGGGGC
AGAGCTGTCAACACCAGGTGGAAAGTTACCGAGGCTGGACAGTGTAGTGAGACTGCAGTT
TAAAGACCACATTGTCCTCACAGTACTGCCGGATCAAGATCAATCTGATGAAGCTCAAGA
AAAGATGGTGTACATCTATCATTCCTTAAAGAATAGTAGAGAGACACACATGATGGGAAA
TGAGGAGGAAACAGAGTTTCATGGACTTCGCTTCCCTTTGTCACATTTGGATGCACTGAA
GCAAATTTGGAATAGTCCAGCTATTTCTGTCAAGGACCTGAAACTTACTACAGATGAGGA
AAAGGAAAGCCTGGTATTATCCCTCTGGACAGAATGTTTAATTCAAGTAGTCTAGTGCCT
TTGCAGAATCAAATGCCTACTATTTTATATGCATATATTAAAAGAAAAGCAAAGACCTGA
GCCGAGGAGAGGATGAATTCAAGTTTCCTTACCTGCGTATCTACTAACAAACATGAGACC
TCCCTGTTACAGGTGGTCAGTTGGCCAAATGTACTAACGGGCACATGAAAGAAAGAACAG
CAAATTACCAAGTGTCTCAGAAAATGACAAAACCATATTTTGACAAGTTTATTTAATCCA
GTGTGGTAGAAAAGGCACAATTCCAATGTATCATTTAGAATTGAATGTCATTAACCTGGC
TTTGTTCTTTGGAAGAAACAACTTCTTTAAAGAGCTTCTTTGGCTCTAGAAAAATTTCAA
ACAATTAAAATAAGAAAAAATTTTAAACTGGTTTTTTATAATGAAAATATACATACCTTT
GTGTATAGACAAGCCCATGCCCATTAAAATAAAGTTATCCTGTAACATAAATTTTATTAA
ATAATACTTCCCCACAGATGAGAGGCACGCAACACCTATGGACAAAAGGGAGTTACAGAG
GCTGCTTAAAAGATGGAGAAAAGCCTGAGATTGAAGGAGGAAAAAAACCCAGTATTTAAA
GTCTATAAAAAATACTCAAAATAGTGGGTCTTCGAGTTTAAAATAGTCATTGTTATTTTA
CATTCTAAAGTGCATGTAGGTTGATATTTTTTAAAATATCATTGGAGAATTTAATCTTTC
TTTATAAAAATAGAGCATTTTTCTGCTTTCTGGCAAAAGTTGGGGATAAAAGGAAAAAAA
GTTGTCAAAATGTAATTTTCAGTCCAATTCACCAGGAAAACATGCTTGTGAATTGTGCAG
TAAAAGGTGGTAATGACTACTGGAAGCTAAGTCAAAGGTGATTTCCTACCTGATTTTACT
TACTTAAATAAAAGTTACTTACAATGGGAGTGAAAAACTGAGGTTTCTGTTATTTAGTAG
AGAAATCAACTCCACGTTTACTTAAAGAGATGGTAAGGTCAAGGTTCAAATGCTACTGTG
TTTTAATTTGGATATTTGAAATTTCTCTTGAGGCAAAAAAAAAAAAAAATTGATGCCTCT
CCTTAAATCTAGGATGAAGTGTCAACATGGAGACAGGTAACCACTGTTATAGAGTCTTGT
CACCTAAAGGGATGTCTTGGTTAACACGTAACAGTGCAAGTTTGGCCATAGGTTATTTAT
TTGTACTTTTTTAGTTTGAAGGACTGAGGAAACAATAGCTACAGAAAATACTTCTTGTGC
CTTATTCCTAACAAAGCTGAGGTCCCTGCCTGGGGTTAGTTACAAGTATAAATACTTAAC
GAGGTGCGTTCATTATAAAAGCCTCAGTATAGAAACCTTAAAGTTTATCTAGGAAAGTTT
AGTATATTTTCAGGTGTTGCTAAAAAATTACTCATCTGTTTGCAAAAGTATGACTTGACC
TATAGAAATCTGTTTCTTTATGCTTTGTACTCATACAAGCATCTAGGTAGGATATTAATA
AATAATACAGGATAATAGCATCACCAGTGTCCAATAACGGGCCATCAGGAACAGGATTCA
CGTTTGGTGGATATGAGAGAAAATAAACACTTCAGGAAACTTGCTCACCACAGCTGGAGA
TCAGGAATAGAACCTTTCCAAGATATCATAATATTTTCTTTATAGGAACACTGAGTAATG
GCAAGAATATTTTGAGCTTTTCCATGGTTAAGAGCGATAGTCTCAGAGGCTGGAGAAAAT
GTTCATTCTGCTCAGTGATCCAGGAGTGTGAGGACAGTAGCTTCCTTTCCACGTCCACAA
GACAATGACAGATGTGTTTCCTTCTTTGCTCTTTCTAGGGATCTTTCTAGGGATGTTGAT
TCTCTCACAATATTTCAATGTCCCATTTCTGTGTTTCTTCTCCCTCCAGGGGCTGATTTA
CAATTACATGAGTCTTGTCACAATAATTTCCTCCTAAAATAGAAATTCCAAAAGAAAAGA
TTATTTGTTCAGGCAGGTGCTTAGCAATTTCACAATTTTCACAAGCTTCTGTTCAGCTCA
CCATTTCGGTGGATGAATGTGTCATTTACAAAGAAGTCTGAAATGGGAAGCTGAGTTTGA
ACAGGCTTAGCCATTATTCACCTCAAATTGGACCTTATTATGACTCAAATTGAAATACTA
AAAGGTATAATACATGATTGTATAAGTGGCGTGCCTTAATGTGATTCTTTAGAACAAAGT
GCTCTTGAGAGAACTCTGGCTGAATGTCAGGTACTGTGTTTTTGTTTCTACACCAACAAA
ACTGTGACTAACCCAATTAAAGCAACAGCCATGAATAATATTGGCCCTGACCTTGCTGAA
TTCAAAAACAAGGTTAATTGATACCTACCATAAATTCTACCTGAGGGTTTTTAAGGACCA
TGGCAATTCCTGGCAAAAAGCTAGAGATGTTTCTAAGAAACAGATGACATTCATTTCATG
GTTTATGGTGCTTGAAATTTAGAACTGTTCTGAGTTCACGTAGCAAATGAAAGTTTTACA
ACTGTACTAATGAACAAAAACCCTAAGCTTTGTTGTTTGGCTTTTTCTGCTAATTGTTTT
GTTTGTAAAACTGCCTATCTTAATTTTCTTCAAGCATAATTTTAAATGACTTAACATTTC
TCTTATACATAAGGATGTCCTTTACCCAAAATGAGGAGATTTGGAACTGAAACTAATATC
CAGGGACACAACATTGGGTATCATCAAAGGCCCACCTTTAACATCAAGGACAAGTTGATC
ACTGAGATAAGAGCTGATAGTTCCATTTTTATTCAGTCTCCACTTCTGCCTGAATTGCCC
ATGTTCAGTCCATAGAGCTACTTTAGCTCCAGGTGTGTCCCGGCCACCAATCACATCAAG
ACATGTATCACTGGCCTAAAAGGGTTAAGAAATGATTAATTGGCAGTAGTATGTTTGCTA
AAGTAAGTTGAATTAGGTCCCTTTTATCTTAGGTAAACAAGTCATAGACATGAAGTGTGT
GTGTGTCTTATCTAAAAAAATACTATATAGTATAATTTCAGTAAGCCTTTTTTAATGTCT
TCTTTACGGCTGTGGGTAGGAGATGGTACAGAAATAAACCAACTGAAATAGAGGTACTTG
TTTTTAATAGGATGTCTACATCTGACAACAGATGTTCAATAAAGATTTGGTGAATTGGAA
TTAAATGTTAAATCCCTGTTTGCTTAAAACGTATTATGTTGAGCTTGGTTTTCTTATGAA
AACATTGCATGATGGGCTAAAGATATCCAGACAATAATTACTTTTAAAAGTTTTTCATTT
TTGAAGCATGAGAAAAAGTAGATAATCCATTGGTGATACAATAAAACACAGTTTGAATGT
TT

Protein Sequence

>84864 : length: 465
MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWE
QKPLLIQRDDPALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAH
FLQLRKDFDQKRATIQFHQPQRFKDELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHY
DDVEVFILQLEGEKHWRLYHPTVPLAREYSVEAEERIGRPVHEFMLKPGDLLYFPRGTIH
QADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTAKEDVELRTGIPRQLLLQVES
TTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAELSTPGGKLPRL
DSVVRLQFKDHIVLTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFP
LSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQVV