ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

84717

Name

HDGFRP2

Synonym

HDGF-2|HDGF2|HRP-2;hepatoma-derived growth factor-related protein 2;-

Definition

-

Position

19p13.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

84717

Links to epithelial mesenchymal transition gene database

84717

Links to ovarian cancer gene database

84717

Links to endometrial cancer gene database

84717

Links to iHOP

84717

Sequence Information

Nucleotide Sequence

>84717 : length: 2386
AAGCGCGCGTCGGCAGGCTGCCCAGACAGCCTCCCCCGCCCCCTCGGCGTCCCGCTCCCG
CCCCCGGCTTCGCCTCCCGCTGCCGCCGCCGCCGCCGCCGCAGCCGCTACCGCCGCTGCA
GCCGCTTTCCGCGGCCTGGGCCTCTCGCCGTCAGCATGCCACACGCCTTCAAGCCCGGGG
ACTTGGTGTTCGCTAAGATGAAGGGCTACCCTCACTGGCCTGCCAGGATCGACGACATCG
CGGATGGCGCCGTGAAGCCCCCACCCAACAAGTACCCCATCTTTTTCTTTGGCACACACG
AAACAGCCTTCCTGGGACCCAAGGACCTGTTCCCCTACGACAAATGTAAAGACAAGTACG
GGAAGCCCAACAAGAGGAAAGGCTTCAATGAAGGGCTGTGGGAGATCCAGAACAACCCCC
ACGCCAGCTACAGCGCCCCTCCGCCAGTGAGCTCCTCCGACAGCGAGGCCCCCGAGGCCA
ACCCCGCCGACGGCAGTGACGCTGACGAGGACGATGAGGACCGGGGGGTCATGGCCGTCA
CAGCGGTAACCGCCACAGCTGCCAGCGACAGGATGGAGAGCGACTCAGACTCAGACAAGA
GTAGCGACAACAGTGGCCTGAAGAGGAAGACGCCTGCGCTAAAGATGTCGGTCTCGAAAC
GAGCCCGAAAGGCCTCCAGCGACCTGGATCAGGCCAGCGTGTCCCCATCCGAAGAGGAGA
ACTCGGAAAGCTCATCTGAGTCGGAGAAGACCAGCGACCAGGACTTCACACCTGAGAAGA
AAGCAGCGGTCCGGGCGCCACGGAGGGGCCCTCTGGGGGGACGGAAAAAAAAGAAGGCGC
CATCAGCCTCCGACTCCGACTCCAAGGCCGATTCGGACGGGGCCAAGCCTGAGCCGGTGG
CCATGGCGCGGTCGGCGTCCTCCTCCTCCTCTTCCTCCTCCTCCTCCGACTCCGATGTGT
CTGTGAAGAAGCCTCCGAGGGGCAGGAAGCCAGCGGAGAAGCCTCTCCCGAAGCCGCGAG
GGCGGAAACCGAAGCCTGAACGGCCTCCGTCCAGCTCCAGCAGTGACAGTGACAGCGACG
AGGTGGACCGCATCAGTGAGTGGAAGCGGCGGGACGAGGCGCGGAGGCGCGAGCTGGAGG
CCCGGCGGCGGCGAGAGCAGGAGGAGGAGCTGCGGCGCCTGCGGGAGCAGGAGAAGGAGG
AGAAGGAGCGGAGGCGCGAGCGGGCCGACCGCGGGGAGGCTGAGCGGGGCAGCGGCGGCA
GCAGCGGGGACGAGCTCAGGGAGGACGATGAGCCCGTCAAGAAGCGGGGACGCAAGGGCC
GGGGCCGGGGTCCCCCGTCCTCCTCTGACTCCGAGCCCGAGGCCGAGCTGGAGAGAGAGG
CCAAGAAATCAGCGAAGAAGCCGCAGTCCTCAAGCACAGAGCCCGCCAGGAAACCTGGCC
AGAAGGAGAAGAGAGTGCGGCCCGAGGAGAAGCAACAAGCCAAGCCCGTGAAGGTGGAGC
GGACCCGGAAGCGGTCCGAGGGCTTCTCGATGGACAGGAAGGTAGAGAAGAAGAAAGAGC
CCTCCGTGGAGGAGAAGCTGCAGAAGCTGCACAGTGAGATCAAGTTTGCCCTAAAGGTCG
ACAGCCCGGACGTGAAGAGGTGCCTGAATGCCCTAGAGGAGCTGGGAACCCTGCAGGTGA
CCTCTCAGATCCTCCAGAAGAACACAGACGTGGTGGCCACCTTGAAGAAGATTCGCCGTT
ACAAAGCGAACAAGGACGTAATGGAGAAGGCAGCAGAAGTCTATACCCGGCTCAAGTCGC
GGGTCCTCGGCCCAAAGATCGAGGCGGTGCAGAAAGTGAACAAGGCTGGGATGGAGAAGG
AGAAGGCCGAGGAGAAGCTGGCCGGGGAGGAGCTGGCCGGGGAGGAGGCCCCCCAGGAGA
AGGCGGAGGACAAGCCCAGCACCGATCTCTCAGCCCCAGTGAATGGCGAGGCCACATCAC
AGAAGGGGGAGAGCGCAGAGGACAAGGAGCACGAGGAGGGTCGGGACTCGGAGGAGGGGC
CAAGGTGTGGCTCCTCTGAAGACCTGCACGACAGCGTACGGGAGGGTCCCGACCTGGACA
GGCCTGGGAGCGACCGGCAGGAGCGCGAGAGGGCACGGGGGGACTCGGAGGCCCTGGACG
AGGAGAGCTGAGCCGCGGGCAGCCAGGCCCAGCCCCCGCCCGAGCTCAGGCTGCCCCTCT
CCTTCCCCGGCTCGCAGGAGAGCAGAGCAGAGAACTGTGGGGAACGCTGTGCTGTTTGTA
TTTGTTCCCTTGGGTTTTTTTTTCCTGCCTAATTTCTGTGATTTCCAACCAACATGAAAT
GACTATAAATGGTTTTTTAATGAAAAAAGAAATCACTTTTAAAAAA

Protein Sequence

>84717 : length: 695
MPGWSSGGLNLGCFWRERDAGPGGPWPSPGARDSDKVALRRPKREGSWIDDIADGAVKPP
PNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYSAPP
PVSSSDSEAPEANPADGSDADEDDEDRGVMAVTAVTATAASDRMESDSDSDKSSDNSGLK
RKTPALKMSVSKRARKASSDLDQASVSPSEEENSESSSESEKTSDQDFTPEKKAAVRAPR
RGPLGGRKKKKAPSASDSDSKADSDGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRG
RKPAEKPLPKPRGRKPKPERPPSSSSSDSDSDEVDRISEWKRRDEARRRELEARRRREQE
EELRRLREQEKEEKERRRERADRGEAERGSGGSSGDELREDDEPVKKRGRKGRGRGPPSS
SDSEPEAELEREAKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEG
FSMDRKVEKKKEPSVEEKLQKLHSEIKFALKVDSPDVKRCLNALEELGTLQVTSQILQKN
TDVVATLKKIRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQKVNKAGMEKEKAEEKLA
GEELAGEEAPQEKAEDKPSTDLSAPVNGEATSQKGESAEDKEHEEGRDSEEGPRCGSSED
LHDSVREGPDLDRPGSDRQERERARGDSEALDEES