ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8451

Name

CUL4A

Synonym

cullin 4A;CUL4A;cullin 4A

Definition

CUL-4A|cullin-4A

Position

13q34

Gene Type

protein-coding

Pathways and Diseases

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

Nucleotide excision repair;KEGG PATHWAY;hsa03420

External Links

Links to cell senescence gene database

8451

Links to epithelial mesenchymal transition gene database

8451

Links to ovarian cancer gene database

8451

Links to endometrial cancer gene database

8451

Links to iHOP

8451

Sequence Information

Nucleotide Sequence

>8451 : length: 4053
ATTCATCCCGCATCCTGCTGGGAAACAGCGTCCATCCGACACAGCACCGCCCACAGCGGG
CCCTCGGCGTGGCCCGCAGGCCCTTCGGACCGCCTGGGAGCGCGGCCACACGTGCCAGCA
AGTGAGGGCAGCGACCTGGGACCGCCGCGTCTACTTACACCGCGACGACTCCGCGATCCA
CGGACACCGCCCGGCCCCCACGGCGGCCCTGCAGGGGAGAACTCGGGCCGCCTTCCCGAG
TCCCGGCCGCCGCTGTTCGGCTCGCGCGGCTGCCCGCCGGGGACCCGAACGGAAAAAGGG
TGGCGAGGCGGGAAAGGAAAAGGCCTGAGGGTCCAAGGCAGGAGGGGACACACGGAACAC
GCCGAGGGCCAACCACGCCGCCGCGCGCTCCCCGGCTAGGACCCACCTGCTGCAGACAGA
CCTCGGCTGCCCGACAACTACACGCAGGACACGTGGCGGAAGCTGCACGAGGCGGTGCGG
GCCGTGCAGAGCAGCACCTCCATCAGGTACAACCTCGAGGAGCTCTACCAGGCTGTGGAA
AATCTCTGTTCTCACAAAGTCTCCCCAATGCTCTACAAGCAACTGCGTCAGGCCTGTGAA
GACCACGTCCAGGCACAGATCCTTCCGTTTAGAGAAGACTCACTAGATAGTGTTTTATTT
TTAAAGAAGATTAACACGTGCTGGCAGGACCACTGCAGACAAATGATCATGATCAGAAGC
ATCTTCCTGTTCTTGGACCGCACCTATGTGCTGCAGAACTCCACGCTGCCCTCCATCTGG
GATATGGGATTAGAACTGTTTAGAACCCATATTATTAGTGATAAAATGGTTCAGAGTAAA
ACCATTGATGGAATCCTACTGCTGATCGAGCGCGAGAGGAGCGGCGAGGCCGTGGACCGG
AGCCTGTTGCGGAGCCTCCTGGGCATGCTGTCTGACCTGCAGGTGTATAAAGATTCATTT
GAACTGAAATTTTTGGAAGAGACTAATTGCTTATATGCTGCCGAAGGCCAAAGGTTAATG
CAGGAAAGAGAGGTTCCAGAATATCTTAACCATGTAAGTAAACGCTTAGAGGAAGAGGGA
GACAGAGTAATCACTTACTTGGACCACAGCACACAGAAACCACTGATTGCTTGTGTGGAG
AAACAGCTATTAGGAGAACATTTAACAGCAATTCTGCAGAAAGGGCTCGACCACTTACTG
GATGAGAACAGAGTGCCGGACCTCGCACAGATGTACCAGCTGTTCAGCCGGGTGAGGGGC
GGGCAGCAGGCGCTGCTGCAGCACTGGAGCGAGTACATCAAGACTTTTGGAACAGCGATC
GTAATCAATCCTGAGAAAGACAAAGACATGGTCCAAGACCTGTTGGACTTCAAGGACAAG
GTGGACCACGTGATCGAGGTCTGCTTCCAGAAGAATGAGCGGTTCGTCAACCTGATGAAG
GAGTCCTTTGAGACGTTCATCAACAAGAGACCCAACAAGCCTGCAGAACTGATCGCAAAG
CATGTGGATTCAAAGTTAAGAGCAGGCAACAAAGAAGCCACAGACGAGGAGCTGGAGCGG
ACGTTGGACAAGATCATGATCCTGTTCAGGTTTATCCACGGTAAAGATGTCTTTGAAGCA
TTTTATAAAAAAGATTTGGCAAAAAGACTCCTTGTTGGGAAAAGTGCCTCAGTCGATGCT
GAAAAGTCTATGTTGTCAAAGCTCAAGCATGAGTGCGGTGCAGCCTTCACCAGCAAGCTG
GAAGGCATGTTCAAGGACATGGAGCTTTCGAAGGACATCATGGTTCATTTCAAGCAGCAT
ATGCAGAATCAGAGTGACTCAGGCCCTATAGACCTCACAGTGAACATACTCACAATGGGC
TACTGGCCAACATACACGCCCATGGAAGTGCACTTAACCCCAGAAATGATTAAACTTCAG
GAAGTATTTAAGGCATTTTATCTTGGAAAGCACAGTGGTCGAAAACTTCAGTGGCAAACT
ACTTTGGGACATGCTGTTTTAAAAGCGGAGTTTAAAGAAGGGAAGAAGGAATTCCAGGTG
TCCCTCTTCCAGACACTGGTGCTCCTCATGTTCAACGAGGGAGATGGCTTCAGCTTTGAG
GAGATAAAAATGGCCACGGGGATAGAGGATAGTGAATTGCGCAGAACGCTGCAGTCCCTG
GCCTGTGGCAAAGCACGTGTGCTGATTAAAAGTCCCAAAGGAAAGGAAGTGGAAGATGGA
GACAAGTTCATTTTTAATGGAGAGTTCAAGCACAAGTTGTTTAGAATAAAGATCAATCAA
ATTCAGATGAAGGAAACTGTTGAGGAACAGGTTAGCACCACTGAGAGAGTGTTTCAGGAT
AGACAATATCAGATTGATGCTGCTATCGTCAGAATAATGAAGATGAGAAAGACTCTTGGT
CATAATCTTCTAGTTTCTGAATTATATAATCAGCTGAAATTTCCAGTAAAGCCTGGAGAT
TTGAAAAAGAGAATTGAATCTCTGATAGACAGAGACTATATGGAGAGAGACAAAGACAAT
CCGAATCAGTACCACTACGTGGCCTGACGCATCTGCAGACGGTTCCCCTTCATGAAACAC
TAGAATGTACCCTCAGAGCAGGAAGCACACCTGTGCCATTTCTGGGACTCTGATTGATCC
AGCTGTGGACATTGGAAGGCGAAGGAAGGGAGGTGGCTCCTGGGTCATCTTTCACAAGGC
TCAAGACTTCAACCTGCAGATGTATCTTTTTCCCTCCAGTTTTTCCTCTAGTTCTTTTAG
GCATTTAAATTGTTTCTGTTACTCTGTGCAAAATAACTTTGAGATTGGACAAGAAGATGT
TACTAAAGAGAAGTTCCTTTAAAAGGTCTTGTTCTTGTGTCAAAAAGCTGCAAGTTTGGT
TTGTTCTCGTGTGTGATCATGAGTGCACAATGAAGAAGACCCTAGATGCTGCATTTTTTA
GCTCTGAAGATTCCTTAGGTATCCCTGAAGACAGCTCGCTCAGATGATCAGCATTTAGAG
TGAAAACAAGGGCCCTTCATGGGTGAACATTAGAAAGAGCCAGGGTTCAAAGCTGGCGAA
TGGATGACGCACCCTAGCCACTGGCCCCTCTCTGTTTCATGTATTTCCAAAAGTTGTAAA
CTTTGATGGCTGATTTTTCGTAAGTCAGGTTTCTAAGTGAGCTCCCTGAGGTGCCAAGGC
CATGGTGTCCGCCCTGCTGCGTCTGTTCGTCAGCTGAGTTCCTTGTGAATCTCTGTTTTA
GGGTTTGGGGCTAGTGTGTTTGTGTTTCCATTCTAAGATTGAGTCTGGCAGTCCCTGTTT
TTTTGCATTGGGGTAACTGCTCTTTGATTTTTTTTAATTGCAGTATTTGTGTGATTGCAA
TAATAAAGTTTGGTTTGGTTTTTACAGTCATGCGCAGGGACGATCCTTGTTCTCTGCTGT
AAACTGTAAAAAGTTTATGGAGACTTAAAGTCTTGATGTTGTGAAGCAGAGGTTATTTTG
TGGAAAGATTAAAAGGATTTTGTTGGTACCTGGTTTTGTGTTGTGTATATATACATGAGG
TTGAACAGTGAAAGGAAAGTTCAGTAGTGATGTTAGAAGGGTAACTATGACAAAGATACT
TTTGAGATAACATTTAAAAGTACTTTATATTTTACATAATAGCATGTTTCATTTTGATTA
AAAGCTACCAAAGGAATTTTGATCATGGCATAAGTGTTTAAAGCAATATTTTCTGGAATA
TACCAAGTTTATATAATTTGATTTTGTGCTAAATTATTAAGAGTCTCTTTTTGAAACATG
CGGGTTTGAAATATGACACCTTGTGGGTTTCCATATTAAAATCCTCACTCTTTAATTGTC
ATTTCTATCTTTGAAAATTTTCATTTATGAGTTCCATGATATGTGGTCTAAGAAAGACCA
AACAGATTTCTATTTTTTTTTTCTTATAAGTTCGTTGTGTCTAGAGATTGTTAATATTGT
AATTTAATGTAGACTTACTTTGAATAAAATTAGTTTAATTGGCCTTAAAATTACATTAAT
AAAACTTTGTGATATGCAAATGAAAAAAAAAAA

Protein Sequence

>8451 : length: 759
MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQ
DTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILP
FREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRT
HIISDKMVQSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETN
CLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLT
AILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKD
MVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAG
NKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLK
HECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPME
VHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLL
MFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEF
KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELY
NQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA