ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

84299

Name

MIEN1

Synonym

C17orf37|C35|ORB3|RDX12|XTP4;migration and invasion enhancer 1;MIEN1;migration and invasion enhancer 1

Definition

HBV X-transactivated gene 4 protein|HBV XAg-transactivated protein 4|protein C17orf37

Position

17q12

Gene Type

protein-coding

External Links

Links to cell senescence gene database

84299

Links to epithelial mesenchymal transition gene database

84299

Links to ovarian cancer gene database

84299

Links to endometrial cancer gene database

84299

Links to iHOP

84299

Sequence Information

Nucleotide Sequence

>84299 : length: 839
GTTCGCGTCACACCCGGAAGCAGGGGCCCGAGCGGAGCCGGCCGCGATGAGCGGGGAGCC
GGGGCAGACGTCCGTAGCGCCCCCTCCCGAGGAGGTCGAGCCGGGCAGTGGGGTCCGCAT
CGTGGTGGAGTACTGTGAACCCTGCGGCTTCGAGGCGACCTACCTGGAGCTGGCCAGTGC
TGTGAAGGAGCAGTATCCGGGCATCGAGATCGAGTCGCGCCTCGGGGGCACAGGTGCCTT
TGAGATAGAGATAAATGGACAGCTGGTGTTCTCCAAGCTGGAGAATGGGGGCTTTCCCTA
TGAGAAAGATGTGAGTATTTACAGCGTTGGGAGGACCTCTTGGTCACCCTACCCCAACAG
TGCATCATCCTGTCATTCCACTCCTCTAGCTCATTGAGGCCATCCGAAGAGCCAGTAATG
GAGAAACCCTAGAAAAGATCACCAACAGCCGTCCTCCCTGCGTCATCCTGTGACTGCACA
GGACTCTGGGTTCCTGCTCTGTTCTGGGGTCCAAACCTTGGTCTCCCTTTGGTCCTGCTG
GGAGCTCCCCCTGCCTCTTTCCCCTACTTAGCTCCTTAGCAAAGAGACCCTGGCCTCCAC
TTTGCCCTTTGGGTACAAAGAAGGAATAGAAGATTCCGTGGCCTTGGGGGCAGGAGAGAG
ACACTCTCCATGAACACTTCTCCAGCCACCTCATACCCCCTTCCCAGGGTAAGTGCCCAC
GAAAGCCCAGTCCACTCTTCGCCTCGGTAATACCTGTCTGATGCCACAGATTTTATTTAT
TCTCCCCTAACCCAGGGCAATGTCAGCTATTGGCAGTAAAGTGGCGCTACAAACACTAA

Protein Sequence

>84299 : length: 116
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLG
GTGAFEIEINGQLVFSKLENGGFPYEKDVSIYSVGRTSWSPYPNSASSCHSTPLAH