ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

83596

Name

BCL2L12

Synonym

BCL2-like 12 (proline rich);BCL2L12;BCL2-like 12 (proline rich)

Definition

Bcl-2 related proline-rich protein|bcl-2-like protein 12

Position

19q13.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

83596

Links to epithelial mesenchymal transition gene database

83596

Links to ovarian cancer gene database

83596

Links to endometrial cancer gene database

83596

Links to iHOP

83596

Sequence Information

Nucleotide Sequence

>83596 : length: 1942
AAGTAAGTATCCCCACTTTCAGGGTAGCATCCTCTTTCCCTAGTTATTTCAGTGCAGAAT
CGATTCACGTGTAAGCCTCTACCTCCTGCACTTACCCCAATGTAGACCCCCTTCCACAGT
CCCCCTACAGAAGATCTCCCAAAACATTTCCAACACAGAACTTCCATTCAATTCCCCTCC
GACTGCCCGCCTCCCTCCTCCAGGACAGAGCACGCCCCAGGTTTCGAGACTGAACTACCC
CCATCTACGGAGTCCACCCCTCCCTCTCTAGAACCCCCTCAGTGTAGACGCCTCCTCTTT
TCCTCTTTCCTCCCTACTTTTTCTAGTTTTTCTGCAGCCGACCTCCAGCGTCGGCCACTG
TAGCTCCTTCCTTGCTCCACTTTCCCCAGAGTACACAGCCTGCCTTTCCACTCTCCGTGC
AGACCCATCCTCTTTCCCGCTCCTCGCTCTCGGACGCCACCAACGCTCTCCCGGGCTCTT
CCGCGTTACCTACGATGGAAGGTCGGGGCGTGCGGGCAGCTGGAACCCACCCCTGTCTTG
GAGCTCCGGGTAGCTCTCAAACTCGAGGCTGCGCACCCCCTTTCCCGTCAGCTGAGCTCT
AGAGCGCTGGGGCTTTCTTTTTGATCGACTTCTTGAAATAAAACCAACTTTATCATTCTT
TGGGTAACAGACCCAAAAGCCGATGGGACGGCCCGCTGGGCTGTTCCCGCCCCTATGCCC
TTTTTTGGGTTTCCGGCCAGAGGCATGCTGGGAGCGTCACATGCAAATTGAGCGTGCACC
CAGCGTTCCGCCCTTTCTACGCTGGGCCGGTTATCGACCCGGCCCAGTGCGCAGGCGCGG
GAAAGTTGAACTAATAAAGTTTGTACGAGTTCAGTGGAGGAGACCGCAAGTTGAGTGGAG
GAGGCGGCGGTGGGGCCCCGGACCAGGTGCCTCCATGGCAGGCTCTGAAGAGCTGGGGCT
CCGGGAAGACACGCTGAGGGTCCTAGCTGCCTTCCTTAGGCGTGGTGAGGCTGCCGGGTC
TCCTGTTCCAACTCCACCTAGAAGCCCTGCCCAAGAAGAGCCAACAGACTTCCTGAGCCG
CCTTCGAAGATGTCTTCCCTGCTCCCTGGGGCGAGGAGCAGCCCCCTCTGAGTCCCCTCG
GCCTTGCTCTCTGCCCATCCGCCCCTGCTATGGTTTAGAGCCTGGCCCAGCTACTCCAGA
CTTCTATGCTTTGGTGGCCCAGCGGCTGGAACAGCTGGTCCAAGAGCAGCTGAAATCTCC
GCCCAGCCCAGAATTACAGGGTCCCCCATCGACAGAGAAGGAAGCCATACTGCGGAGGCT
GGTGGCCCTGCTGGAGGAGGAGGCAGAAGTCATTAACCAGAAGGTGATGGGCATCTGTCC
CACTCCTTGGCAAGGACAGGAGTTGCGGAATGCTGGCCTCGGACCCCGCCCTGCGCAGCA
AGCTGGTCCGCCTGTCCTCCGACTCTTTCGCCCGCCTGGTGGAGCTGTTCTGTAGCCGGG
ATGACAGCTCTCGCCCAAGCCGAGCATGCCCCGGGCCCCCGCCTCCTTCCCCGGAGCCCC
TGGCCCGCCTGGCCCTAGCCATGGAGCTGAGCCGGCGCGTGGCCGGGCTGGGGGGCACCC
TGGCCGGACTCAGCGTGGAGCACGTGCACAGCTTCACGCCCTGGATCCAGGCCCACGGGG
GCTGGGAGGGCATCCTGGCTGTTTCACCCGTGGACTTGAACTTGCCATTGGACTGAGCTC
TTTCTCAGAAGCTGCTACAAGATGACACCTCATGTCCCTGCCCTCTTCGTGTGCTTTTCC
AAGTCTTCCTATTCCACTCAGGGCTGTGGGGTGGTGGTTGCCCTACCTGTTTTTGCCAAA
AATAAATTGTTTAAAACTTTTCTTATTAAAAACGTTACAAAGTAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>83596 : length: 334
MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKF
VRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPR
SPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQ
RLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVR
LSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGL
SVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD