ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8328

Name

GFI1B

Synonym

BDPLT17;growth factor independent 1B transcription repressor;GFI1B;growth factor independent 1B transcription repressor

Definition

growth factor independent 1B (potential regulator of CDKN1A, translocated in CML)|potential regulator of CDKN1A translocated in CML|zinc finger protein Gfi-1b

Position

9q34.13

Gene Type

protein-coding

External Links

Links to cell senescence gene database

8328

Links to epithelial mesenchymal transition gene database

8328

Links to ovarian cancer gene database

8328

Links to endometrial cancer gene database

8328

Links to iHOP

8328

Sequence Information

Nucleotide Sequence

>8328 : length: 2479
CTTTATTGCGAGGCTGAGTATGATGGGCTCCATCCAGCACGAACACAAAGCCCTGTGAGA
GGAGGCAGAGTGAGATGAAGTCGAACTGTGGGATATGAAAGGCATTTTGAAGGAGTAGGC
ATCAGGCTGGTTTTTGTTCGAGGAAAGCTACTCAGGAGCTTGGGAGGATTGCTTGAGACC
AGGAGTTCAAGACCAGCCTGGGCTACAGAGCAAGACCCCATCTTTTTGAAACTTCCTGCA
ACTCGCATCTGGAAAAGTGCTGTTATTTGAAAGGGTGCCGACATTGTGAAAAACACGGAG
TATTGATCTCTGAAGCTGAGATTTTTGTCCTAAAGAATACTCAAGATGTGTCCCTGGCTG
GGCACAGCAGCTCGTGCCTGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGAGGATCGCT
TGAGGCCAGGAGTTCAAGACCAGCCTATTGTGAATAGTACCACTATAAATAGAGAAAGCG
TGCCGCTCCAAGTGTCGAGGGTTAGAAATGAGAATTCGAAGTCTTGTGTCCTGGAAAGTT
TTGATAAGCAAATACGGCTGAGCTCCCGCGCTCTCTTCATTGGCTGCTTGTTCACCGCCA
GATTTTGACACAAATAATCAGATTGAAAATCAGGGAGGGGAACAGAAGAGGAAAAACACA
CAGAGAGACAGAGCAAAAAGGAGAAGTATCTATTTGTGCAAAGAGTCACACAGTTGACAG
AGTGGAGGCCAGTCCCGAGAGAGGCTTTGCAGTTCCCACCTCGGGAAGCTCCGGCAGAAC
CCAGGCGAGGGACAGCTCCGGACAGGTGTGGGGTGCACACTGAAAATGCCACGCTCCTTC
CTGGTGAAGAGCAAGAAGGCTCACACCTACCACCAGCCCCGTGTGCAGGAAGATGAACCG
CTCTGGCCTCCTGCCCTTACCCCGGTGCCCAGAGACCAGGCTCCAAGCAACAGCCCTGTC
CTTAGCACTCTATTCCCAAACCAGTGCCTGGACTGGACCAACCTCAAACGAGAGCCGGAG
CTGGAGCAGGACCAGAACTTGGCCAGGATGGCCCCGGCACCAGAGGGCCCCATTGTGCTG
TCCCGACCCCAGGATGGGGACTCTCCACTGTCCGACTCACCCCCATTCTACAAGCCTAGC
TTCTCCTGGGACACCTTGGCCACAACCTATGGCCACAGCTACCGGCAGGCCCCCTCCACC
ATGCAGTCAGCCTTCCTGGAGCACTCCGTCAGCCTGTACGGCAGTCCTCTTGTGCCCAGC
ACTGAGCCCGCCTTGGACTTCAGCCTCCGCTACTCCCCAGGCATGGATGCGTACCACTGT
GTGAAGTGCAACAAGGTCTTCTCCACCCCTCACGGGCTCGAAGTGCATGTGCGACGCTCC
CATAGTGGGACCCGGCCCTTCGCCTGTGACATCTGCGGCAAAACCTTCGGCCACGCTGTG
AGCCTGGAGCAGCACACGCACGTCCACTCCCAGGAGCGCAGCTTCGAGTGCCGCATGTGC
GGCAAGGCCTTCAAGCGCTCGTCCACGCTGTCCACCCACCTGCTCATCCACTCAGACACG
CGGCCCTACCCCTGCCAGTTCTGCGGCAAGCGTTTCCACCAGAAGTCCGACATGAAGAAG
CACACCTACATCCACACAGGTGAGAAGCCGCACAAGTGCCAGGTGTGCGGAAAGGCCTTC
AGCCAGAGCTCCAACCTCATCACCCACAGCCGCAAGCACACAGGCTTCAAGCCCTTCAGC
TGTGAGCTGTGCACCAAAGGCTTCCAGCGCAAGGTGGACCTGCGGCGGCACCGCGAGAGC
CAGCACAATCTCAAGTGAGGCTGCGCCGGCTCCCAGCTCCTGGCCAGCCTGCCCTGCGGT
CCTGTCACCTGGAGGCCAGCCTCACATGCCCAAATCTCCAGTCTCCTGGAGGTGGGACTG
GACAGGAGTCTACCAGCTTGTTTTGAGACTCATGAAATTGCTGTGTGACCTTGGGCAAGT
CACTTACCCTGTCTGGATCAACATTTCTCCTGCTGCCAAGTGTGGGAGCCTGGCTGGGTC
TTTCTCAGCAGAAGTTGTTTCCAGGTGTGCTCAAGTGCCTTCCTCTAGCAGAGCACAGAA
AGCTAGAATACCCCCAGGGAGACAGGGATGCCAAGAGTAGACCAGAGCTGGGACCCACAG
ACAGAACCTCCACCTGCCTGCTGCCCACTGAGCTGGGACCTGGTCACCTTGGATTTTAGC
CGGCCTCTTTCTGGCTATAACAGGCAGAGTCGGAGCTGCCTCCCACCCCAGTCAGAAGCC
TGGCACCCCCTCTGCTTCGGCCAGATGTGCTGGCTGACTCCGACTTCCGACCAGCACTCA
GCTGGCCTCTGGGGATTCTAGCTCCACAACCAGGCCGTGAGGCTGGAGAAACTGGCAGTT
ATTGCTGTCAAAAGCCTGTTCTCTCAACTGCTGTCAATAAAATTAAAGATACAGAAAAAA
AAAAAAAAAAAAAAAAAAA

Protein Sequence

>8328 : length: 352
MPRSFLVKSKKAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLFPNQCLDWTNL
KREPELEQDQNLARMAPAPEGPIVLSRPQDGDSPLSDSPPFYKPSFSWDTLATTYGHSYR
QAPSTMQSAFLEHSVSLYGSPLVPSTEPALDFSLRYSPGMDAYHCVKCNKVFSTPHGLEV
HVRRSHSGTRPFACDICGKTFGHAVSLEQHTHVHSQGIPAGSSPEPAPDPPGPHFLRQER
SFECRMCGKAFKRSSTLSTHLLIHSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGEKPHKC
QVCGKAFSQSSNLITHSRKHTGFKPFSCELCTKGFQRKVDLRRHRESQHNLK