ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8277

Name

TKTL1

Synonym

TKR|TKT2;transketolase-like 1;TKTL1;transketolase-like 1

Definition

TK 2|transketolase-2|transketolase-like protein 1|transketolase-related protein

Position

Xq28

Gene Type

protein-coding

Pathways and Diseases

Pathway

pentose phosphate pathway (non-oxidative branch);BioCyc;NONOXIPENT-PWY

Pathway

pentose phosphate pathway;BioCyc;PENTOSE-P-PWY

Pathway

Pentose phosphate pathway;KEGG PATHWAY;hsa00030

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

External Links

Links to cell senescence gene database

8277

Links to epithelial mesenchymal transition gene database

8277

Links to ovarian cancer gene database

8277

Links to endometrial cancer gene database

8277

Links to iHOP

8277

Sequence Information

Nucleotide Sequence

>8277 : length: 2652
TCCCTTGACTTGCTTGCGGAGGGAGCGGCCGGCGGAGGGAGCGGCAGGTGGAGGGAGTGG
CACGAGGCATGCGGAGGGAGCTGCACCGACATCACATAAACGCACTGGGCAGCTCGCAGG
CGCCATTCGCTCTTCAGACGCCGGAGACGTAGGAGTGGGTCTTCAGACTCCAAAGGGGTT
GGACTAATGGCGGATGCTGAGGCGAGGGCTGAGTTCCCGGAGGAGGCCAGACCTGACAGG
GGCACCTTGCAGGTGTTGCAAGATATGGCCAGCCGCTTGCGAATCCATTCCATCAGGGCC
ACATGCTCCACGAGCTCCGGCCACCCTACATCATGTAGCAGTTCTTCTGAGATCATGTCT
GTGCTGTTCTTCTACATCATGAGGTACAAGCAGTCAGATCCAGAGAATCCGGACAACGAC
CGATTTGTCCTCGCAAAGAGACTGTCGTTTGTGGATGTGGCAACAGGATGGCTCGGACAA
GGACTGGGAGTTGCATGTGGAATGGCATATACTGGCAAGTACTTCGACAGGGCCAGCTAC
CGGGTGTTCTGCCTCATGAGTGATGGCGAGTCCTCAGAAGGCTCTGTCTGGGAGGCAATG
GCCTTTGCTTCCTACTACAGTCTGGACAATCTTGTGGCAATCTTTGATGTGAACCGCCTG
GGACACAGTGGTGCATTGCCCGCCGAGCACTGCATAAACATCTATCAGAGGCGCTGCGAA
GCCTTTGGGTGGAACACTTATGTGGTGGACGGCCGGGACGTGGAGGCACTGTGCCAGGTA
TTCTGGCAGGCTTCTCAGGTGAAGCACAAGCCCACTGCTGTGGTGGCCAAGACCTTCAAG
GGCCGGGGCACCCCAAGTATTGAGGATGCAGAAAGTTGGCATGCAAAGCCAATGCCGAGA
GAAAGAGCAGATGCCATTATCAAATTAATTGAGAGCCAGATACAGACCAGCAGGAATCTT
GACCCACAGCCCCCCATTGAGGACTCACCTGAAGTCAACATCACAGATGTAAGGATGACC
TCTCCACCTGATTACAGAGTTGGTGACAAGATAGCTACTCGGAAAGCATGCGGTCTGGCT
CTGGCTAAGCTGGGCTACGCGAACAACAGAGTCGTTGTGCTGGATGGTGACACCAGGTAC
TCTACTTTCTCTGAGATATTCAACAAGGAGTACCCTGAGCGCTTCATCGAGTGCTTTATG
GCTGAACAAAACATGGTGAGCGTGGCTCTGGGCTGTGCCTCCCGTGGACGGACCATTGCT
TTTGCTAGCACCTTTGCTGCCTTTCTGACTCGAGCATTTGATCACATCCGGATAGGAGGC
CTCGCTGAGAGCAACATCAACATTATTGGTTCCCACTGTGGGGTATCTGTTGGTGACGAT
GGTGCTTCCCAGATGGCCCTGGAGGATATAGCCATGTTCCGAACCATTCCCAAGTGCACG
ATCTTCTACCCAACTGATGCCGTCTCCACGGAGCATGCTGTTGCTCTGGCAGCCAATGCC
AAGGGGATGTGCTTCATTCGGACCACCCGACCAGAAACTATGGTTATTTACACCCCACAA
GAACGCTTTGAGATCGGACAGGCCAAGGTCCTCCGCCACTGTGTCAGTGACAAGGTCACA
GTTATTGGAGCTGGAATTACTGTGTATGAAGCCTTAGCAGCTGCTGATGAGCTTTCGAAA
CAAGATATTTTTATCCGTGTCATCGACCTGTTTACCATTAAACCTCTGGATGTCGCCACC
ATCGTCTCCAGTGCAAAAGCCACAGAGGGCCGGATCATTACAGTGGAGGATCACTACCCG
CAAGGTGGCATCGGGGAAGCTGTCTGCGCAGCCGTCTCCATGGATCCTGACATTCAGGTT
CATTCGCTGGCAGTGTCGGGAGTGCCCCAGAGTGGGAAGTCCGAGGAATTGCTGGATATG
TATGGAATTAGTGCCAGACATATCATAGTGGCCGTGAAATGCATGTTGCTGAACTAAAAT
AGCTGTTAGCTTTGGTCTTTTGGCCTCTTTACCCTGTGTTTATGTTTGTTCCAAAACCAT
CATTTAAATCTCTACTGTCACATTTTGTTTCTTAAAAGCAAAGCCAGCTAACACCTTCAT
TCATCCCTAGTTCGGAAATTCAAGCTAACTACTTACCCTTTAAACTGTCACTGCATATGC
AAGTACCGCTCTAATTTTTGGATCATTAAAGGGAGTTACACAACTTTTAAGTGAAAAAAA
TAGGTAACAAAACAACCACCTGATAGTAAGTTTTCTGATAAGACTATAGATAAGTGGTAG
AGGTAATCAATTCTTCCGAAGTGTTTCCTTCGTGAATAACTGGTAGAGGTAATAGTTTTT
TCAATGTATTTCCTTCATGAGTAAAGAAAATGTGGATTGAAGTATAGATTCCAGTAGCCT
AGTTTCCACAGCACGATAACACCATGACGCCTACTGCTGTTCCCACCTTGGGATTCTGTG
TGCTGCCATCCCACCTGCAGCTGCCCTGGAATTCCCTTCGCTGTTTGCCTTCATCTCCCT
CCACGTTTGAGAGGCTGTCAGGCAGCAGCGAAAGCTTGTTAGGATGTCCTGTGCTGCTTG
TGATGAGAGCCTCCACACTGTACTGTTCAAGTCAATGTTAATAAAGCATTTCAAAACCAG
CTGCTTTATTCA

Protein Sequence

>8277 : length: 596
MADAEARAEFPEEARPDRGTLQVLQDMASRLRIHSIRATCSTSSGHPTSCSSSSEIMSVL
FFYIMRYKQSDPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRV
FCLMSDGESSEGSVWEAMAFASYYSLDNLVAIFDVNRLGHSGALPAEHCINIYQRRCEAF
GWNTYVVDGRDVEALCQVFWQASQVKHKPTAVVAKTFKGRGTPSIEDAESWHAKPMPRER
ADAIIKLIESQIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA
KLGYANNRVVVLDGDTRYSTFSEIFNKEYPERFIECFMAEQNMVSVALGCASRGRTIAFA
STFAAFLTRAFDHIRIGGLAESNINIIGSHCGVSVGDDGASQMALEDIAMFRTIPKCTIF
YPTDAVSTEHAVALAANAKGMCFIRTTRPETMVIYTPQERFEIGQAKVLRHCVSDKVTVI
GAGITVYEALAAADELSKQDIFIRVIDLFTIKPLDVATIVSSAKATEGRIITVEDHYPQG
GIGEAVCAAVSMDPDIQVHSLAVSGVPQSGKSEELLDMYGISARHIIVAVKCMLLN