ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

822

Name

CAPG

Synonym

AFCP|HEL-S-66|MCP;capping protein (actin filament), gelsolin-like;CAPG;capping protein (actin filament), gelsolin-like

Definition

actin regulatory protein CAP-G|actin-regulatory protein CAP-G|epididymis secretory protein Li 66|gelsolin-like capping protein|macrophage capping protein|macrophage-capping protein

Position

2p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

FAS signaling pathway;PANTHER;P00020

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

822

Links to epithelial mesenchymal transition gene database

822

Links to ovarian cancer gene database

822

Links to endometrial cancer gene database

822

Links to iHOP

822

Sequence Information

Nucleotide Sequence

>822 : length: 1604
CTGAATGGAGAACATGGCTTTCCTTGCTGGTCTCAGACTCAGAGATGCCCTCCCTGATTT
GCCTTGGCTGTGACCTGCAGCGGGCTGAGGCCACTGTGGTGGGGCTGTGTGGACCTCCAG
CCTCCCTGTGTGCCCCTCTGAGGAGACGGCCTGGCATACCCACTGCCCACCCCAGTGACT
GCTCTTCTGCTTCAGGCCTGCTGGCCTCCCAGCACTGCCTGCCCCTCCCTGTCGGGGGAC
ATCGCCTCCACACCGGCTGGGGAAGGAGCCCAGGGGTGGGGCTGGTGGGTGGGGCTGGTG
GTTGGGGCAGCCAGAGAAGTAAGAGGGAAGTGAGAAGCCGGGTGGGGCAGGCTGGAAGGA
AGACGAACCTACGAAGCAGAGATCTGAAGACAGCATGTACACAGCCATTCCCCAGAGTGG
CTCTCCATTCCCAGGCTCAGTGCAGGATCCAGGCCTGCATGTGTGGCGGGTGGAGAAGCT
GAAGCCGGTGCCTGTGGCGCAAGAGAACCAGGGCGTCTTCTTCTCGGGGGACTCCTACCT
AGTGCTGCACAATGGCCCAGAAGAGGTTTCCCATCTGCACCTGTGGATAGGCCAGCAGTC
ATCCCGGGATGAGCAGGGGGCCTGTGCCGTGCTGGCTGTGCACCTCAACACGCTGCTGGG
AGAGCGGCCTGTGCAGCACCGCGAGGTGCAGGGCAATGAGTCTGACCTCTTCATGAGCTA
CTTCCCACGGGGCCTCAAGTACCAGGAAGGTGGTGTGGAGTCAGCATTTCACAAGACCTC
CACAGGAGCCCCAGCTGCCATCAAGAAACTCTACCAGGTGAAGGGGAAGAAGAACATCCG
TGCCACCGAGCGGGCACTGAACTGGGACAGCTTCAACACTGGGGACTGCTTCATCCTGGA
CCTGGGCCAGAACATCTTCGCCTGGTGTGGTGGAAAGTCCAACATCCTGGAACGCAACAA
GGCGAGGGACCTGGCCCTGGCCATCCGGGACAGTGAGCGACAGGGCAAGGCCCAGGTGGA
GATTGTCACTGATGGGGAGGAGCCTGCTGAGATGATCCAGGTCCTGGGCCCCAAGCCTGC
TCTGAAGGAGGGCAACCCTGAGGAAGACCTCACAGCTGACAAGGCAAATGCCCAGGCCGC
AGCTCTGTATAAGGTCTCTGATGCCACTGGACAGATGAACCTGACCAAGGTGGCTGACTC
CAGCCCATTTGCCCTTGAACTGCTGATATCTGATGACTGCTTTGTGCTGGACAACGGGCT
CTGTGGCAAGATCTATATCTGGAAGGGGCGAAAAGCGAATGAGAAGGAGCGGCAGGCAGC
CCTGCAGGTGGCCGAGGGCTTCATCTCGCGCATGCAGTACGCCCCGAACACTCAGGTGGA
GATTCTGCCTCAGGGCCATGAGAGTCCCATCTTCAAGCAATTTTTCAAGGACTGGAAATG
AGGGTGGGCGTCTTCCTGCCCCATGCTCCCCTGCCCCCCACCACCTGCCTGCTTGCTTCT
CTGGCTGCCTGGTCAGTGCAGAGGTGCCCCCTGCAGATGTTCAATAAAGGAGACAAGTGC
TTTCCCAGCTCTTTTCCTGCACCACCAAAAAAAAAAAAAAAAAA

Protein Sequence

>822 : length: 348
MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSH
LHLWIGQQSSRDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGG
VESAFHKTSTGAPAAIKKLYQVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGG
KSNILERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLT
ADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRK
ANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK