ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8178

Name

ELL

Synonym

C19orf17|ELL1|MEN|PPP1R68;elongation factor RNA polymerase II;ELL;elongation factor RNA polymerase II

Definition

ELL gene (11-19 lysine-rich leukemia gene)|RNA polymerase II elongation factor ELL|eleven-nineteen lysine-rich leukemia protein|protein phosphatase 1, regulatory subunit 68

Position

19p13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

RNA Polymerase II Transcription Elongation;PID Reactome;500566

Pathway

RNA Polymerase II Transcription;PID Reactome;500924

Pathway

Transcription of the HIV genome;PID Reactome;500735

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Gene Expression;Reactome;REACT:71

Pathway

Formation of HIV-1 elongation complex containing HIV-1 Tat;PID Reactome;500741

Pathway

Pausing and recovery of Tat-mediated HIV-1 elongation;PID Reactome;500990

Pathway

Pausing and recovery of HIV-1 elongation;PID Reactome;500871

Pathway

Pausing and recovery of elongation;Reactome;REACT:769

Pathway

Elongation arrest and recovery;PID Reactome;500956

Pathway

Formation of HIV-1 elongation complex in the absence of HIV-1 Tat;PID Reactome;500742

Pathway

HIV-1 elongation arrest and recovery;PID Reactome;501028

Pathway

Elongation arrest and recovery;Reactome;REACT:1892

Pathway

Formation of RNA Pol II elongation complex;PID Reactome;500568

Pathway

Transcription;Reactome;REACT:1788

Pathway

Tat-mediated HIV-1 elongation arrest and recovery;PID Reactome;500957

Pathway

Pausing and recovery of elongation;PID Reactome;500922

Pathway

RNA Polymerase II Pre-transcription Events;PID Reactome;500949

Pathway

Tat-mediated elongation of the HIV-1 transcript;PID Reactome;500917

External Links

Links to cell senescence gene database

8178

Links to epithelial mesenchymal transition gene database

8178

Links to ovarian cancer gene database

8178

Links to endometrial cancer gene database

8178

Links to iHOP

8178

Sequence Information

Nucleotide Sequence

>8178 : length: 4077
GGCGGGGCGGGGCGTGGCCGGCGTGGCGGCGCTGGAGCCGGGAAGGGGGCGCGGGGGAGA
GATGGTCGCAAGATGGCGGCGCTGAAGGAGGATAGGAGCTACGGGCTGTCGTGCGGGCGG
GTTAGCGACGGCAGCAAGGTGTCGGTGTTCCACGTGAAGCTCACCGACAGTGCCCTGAGG
GCCTTCGAGAGCTACCGCGCCAGACAGGATTCTGTTTCACTGAGGCCATCTATCCGATTT
CAAGGAAGCCAAGGGCACATCTCCATCCCCCAGCCTGACTGCCCCGCAGAGGCGCGGACG
TTCTCCTTCTACCTCTCCAACATCGGCCGCGACAACCCCCAGGGCAGCTTCGACTGCATC
CAGCAGTATGTCTCCAGTCATGGGGAAGTTCACCTGGACTGCCTGGGCAGCATACAGGAC
AAGATCACGGTGTGTGCCACCGACGACTCCTACCAGAAGGCGCGGCAGAGCATGGCCCAG
GCGGAGGAGGAGACGCGGAGCCGAAGTGCCATTGTCATCAAGGCTGGAGGCCGCTACCTG
GGCAAGAAGGTTCAGTTTCGGAAACCAGCCCCAGGTGCAACAGACGCGGTGCCCTCCCGG
AAGCGGGCAACCCCCATCAACTTGGCGAGTGCCATCAGGAAGAGTGGTGCCAGTGCCGTG
AGTGGGGGCAGCGGGGTGTCCCAGAGGCCCTTCCGTGACCGAGTGCTGCACCTCCTGGCA
CTACGGCCCTACCGCAAGGCTGAGCTGCTGCTGCGACTGCAGAAGGACGGCCTGACGCAG
GCGGACAAGGACGCGCTGGATGGCCTCCTCCAGCAGGTGGCCAACATGAGTGCTAAGGAC
GGCACGTGTACACTGCAGGACTGCATGTACAAGGATGTGCAGAAGGACTGGCCTGGCTAC
TCGGAGGGGGACCAGCAGCTGCTGAAGCGGGTGCTCGTCCGGAAGCTGTGCCAGCCACAG
AGCACTGGCAGCCTCCTTGGAGACCCTGCTGCCTCCAGCCCCCCAGGCGAGCGTGGGCGC
TCGGCCTCGCCCCCACAGAAGCGGCTGCAGCCTCCTGATTTCATCGACCCCCTAGCCAAC
AAGAAACCCCGGATATCGCACTTCACTCAGAGAGCTCAGCCTGCCGTCAACGGGAAGCTG
GGCGTGCCCAATGGCCGTGAGGCCTTGCTGCCCACCCCGGGCCCACCAGCCAGCACGGAC
ACCCTCAGCTCCAGCACTCACCTGCCCCCGCGGCTGGAGCCCCCGAGGGCCCACGACCCC
CTGGCCGATGTCAGCAATGACCTGGGCCACAGCGGCCGAGACTGTGAGCACGGAGAGGCG
GCTGCCCCAGCCCCCACTGTGCGCCTCGGCCTGCCCCTGCTGACGGACTGTGCCCAGCCC
AGCAGGCCACACGGCAGCCCCTCGCGCAGCAAGCCCAAGAAGAAGTCCAAGAAGCACAAA
GACAAGGAGAGGGCGGCTGAGGACAAGCCCCGGGCCCAGCTTCCAGACTGTGCACCTGCC
ACCCATGCCACCCCCGGAGCCCCAGCAGACACCCCAGGTTTAAACGGAACCTGCAGCGTT
TCCAGTGTTCCCACGTCCACGTCGGAGACGCCTGACTACTTGCTGAAGTACGCAGCCATC
TCCTCTTCGGAGCAGCGCCAGAGCTACAAGAACGACTTCAATGCCGAGTACAGCGAGTAC
CGCGACCTGCACGCCCGCATTGAGCGCATCACGCGGCGGTTCACCCAGCTCGACGCCCAG
CTCCGGCAGCTCTCCCAGGGCTCCGAGGAGTATGAGACTACTCGAGGGCAGATTTTGCAG
GAATATCGAAAAATCAAAAAGACCAACACCAACTACAGCCAGGAGAAGCACCGCTGCGAG
TACCTGCACAGCAAGCTGGCCCACATCAAGAGGCTCATCGCCGAGTACGACCAGCGGCAG
CTGCAGGCTTGGCCCTAGCCGCCCTCCCCGATGGCGGGGATCTGGGAGGGTCGGGGGAGC
AAAAGGCGGTGAGAGAGGATTTATTTAAAAAAATAAACCCGAGGAAGATGCTCATCTGAG
CCAGCACCGCCGGCTTTCAGGGCAGCCCCTGCAGACGTCTGGCCCTGGCGGGTGGCTGCA
AGCCCACCTCGGCCCTCCCTGCGCTTCCTGAGCAGTCCCTGCTTATGATGGGCTCCCCAG
GAAGCCCACTGCCTCCTCCCTGGCTGCAGCCTCCGGGGTTCAGCCTCCTGTCTCGCCAGA
AGACTCCTAGGCCCTTGGGGTGGCGCGCCTGCCTTTTCTAGTTTTATACAAAGACAGCCA
CTTTTAGCTACTGCTAATGAGACTTGAGTCTATTTTTGTACAAAAGAGAAGCAAAATCTT
TTTTCTAAACCTGTGCCTCCCTCTCCTCGGACACCCAGGGTCTAGCCGCTGCCCTGGGTC
CTGCCTGCAGTATTACAGAGGTCGTCGAAAGGTGCAGCTGCGTTCTGAGGGCGTGGGGAA
TGGGCAGGTGGCCTCTGCTGGTCTCTGGCTCTACGTTTAGGCACCCCTTTCCCCAGCCTC
TCCTCCTTGGGCAGGGTCTCTGCTCCAGCAAGCAAACAGGGTGGCCCAGGTGGCTATTTT
GAGAACTCCAGCTGGTGCCCCCAGACAGCTGCTCAGAGCCAAGGGGGCAGAGGGCTTTCA
GCGCCCCCAGGCCTGCCCTGCTATTTCAGGCCCTCAGCTGTCGGGGGCCACTGTGTTTCT
GTGCTCCAAGTTGAGACTCGGCCGCAGCGGCGTCAGACTTTTCTTTGCGATGTCCTCGGT
TTCCCATTTGTTGCTGCTGCTGCTCATTCCACACTGTTGAGACCTTGTGGTCTCGATGCT
GCTGGCCTCCCTCCGTCCCTCTGTCCACTTGTGGGTCCTGGGGTCGTCTTAGCAGAGCCA
CCGCCAAGGTTTGCACTCAGGGAGGGGCTGATGGAGGGCTGGGCGCCATGGGGTCAGGGA
GGCCCCAGGGACCCATGGGCAGAGCTGGGGAGCCAGGAGGATGGGTCTGCCTGCTCTGGG
GGTGCAGGCTCTGCAGACACCCCAATTGCTGCTCTGTTGCTGTGCCTAGTCTAGTGTCCC
CCAAAGCATCGGGGGGCCACGCAAGTGTGGGTGTGTGAGTGTGCGTATGTGGGGACCCCC
CAGGGCATGGTGGGGTCTGAGGCGTGTGTTCCCATTTAGGGCTGAATGAAGCCATGACTT
GGAAAGGTGGTGGGGGGTGGATGGCGGCTGTGACTCAGGGCCCAGGGATCACATGGGGGT
CACTGCTGCCATCAGCAGTCAGGCAGGGAGAACAGAAATGCAAAAATACAGATGTCTATT
TTTCTAAACTGGGGGGTGGAGGGGTGCCTCCTGACAGCTTCCAAAGAGCTGACTGTGGAG
GGCCCACAGTGTATCCCACCCCTGCCCGAGAGTCTCTCTCCTTTGGGACCCCCGGGTTCC
CAGAGCTCCGAGGAAACTGATCCTTCATGTTTCAATAGCTGTTGTTGTTTTTCTCTTTGG
GCCGGGCCGGGCCGGGGAAGGGCCGAGCAGGCTCCAGGAGGCCTCCAGAGTCAGCTGGAC
CTTGCTGTGTCGCCCGCAGGCAGCCCTGCAGACACCGGTGAGGTGGGATGATTTCAGGAG
GTCCCAGCCCGGGACTGCCCGCCCCTCTGCCCTGGGAACCAGTCCAAGGGGCTGTCAGTT
GAATTTGCCTTTTTGTTGTTGTTGTTGTTTTTGTTGTTTATTTGTTCTCCTTTTAAGGAA
TTATGAAGCTAAGAAAAGTTTTGTGTTTTGGGGGTTGGTGGACAAAGTTCTAGCTGATTA
AATATGGTCTAACTTATTGATACTATTTTTTTTTCTTTTAATGTTGTACTGTGGAGAAAA
ACTATTTTGAGCCATGGGGTTGGTGTTTACAAGAACTTTCCACTTTTGCCAAAATGTTAC
AATTGAAAGGCATCTATCTGCGTCTTCAGTTTCCTGATATTTTCTTAAAAGATCTAGTGT
CCTTTTTGTACACTAAACAGGTGAATGCTGACTTTTTTCATTCTCCAATAAATTTCACTG
AACTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>8178 : length: 621
MAALKEDRSYGLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQ
GHISIPQPDCPAEARTFSFYLSNIGRDNPQGSFDCIQQYVSSHGEVHLDCLGSIQDKITV
CATDDSYQKARQSMAQAEEETRSRSAIVIKAGGRYLGKKVQFRKPAPGATDAVPSRKRAT
PINLASAIRKSGASAVSGGSGVSQRPFRDRVLHLLALRPYRKAELLLRLQKDGLTQADKD
ALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTGS
LLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQPAVNGKLGVPN
GREALLPTPGPPASTDTLSSSTHLPPRLEPPRAHDPLADVSNDLGHSGRDCEHGEAAAPA
PTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHAT
PGAPADTPGLNGTCSVSSVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLH
ARIERITRRFTQLDAQLRQLSQGSEEYETTRGQILQEYRKIKKTNTNYSQEKHRCEYLHS
KLAHIKRLIAEYDQRQLQAWP