ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

81610

Name

FAM83D

Synonym

C20orf129|CHICA|dJ616B8.3;family with sequence similarity 83, member D;FAM83D;family with sequence similarity 83, member D

Definition

protein FAM83D|spindle protein CHICA

Position

20q11.23

Gene Type

protein-coding

External Links

Links to cell senescence gene database

81610

Links to epithelial mesenchymal transition gene database

81610

Links to ovarian cancer gene database

81610

Links to endometrial cancer gene database

81610

Links to iHOP

81610

Sequence Information

Nucleotide Sequence

>81610 : length: 2445
AAAGCAGCCAATGGGAGAGCCGAGGCGGGGAGGTGCGGCCAATGGCGCGGGCCTGTTTGA
TTCAAAGGTTGCCTATAAAGCGGGACTGCACGCCGGTTTTTGTCCGAGGGCTGTCGAGTC
CGAGCGCCGCCATGGCTCTGCTGTCCGAGGGCCTGGACGAGGTGCCCGCCGCCTGCCTGT
CGCCGTGCGGGCCGCCCAACCCGACCGAGCTGTTCAGCGAGTCACGGCGCCTGGCTCTGG
AGGAGCTGGTGGCGGGCGGCCCCGAAGCCTTCGCGGCCTTCCTGCGACGCGAGCGCCTGG
CTCGTTTCCTGAACCCCGATGAGGTGCACGCCATTCTGCGCGCGGCGGAGAGGCCGGGAG
AGGAGGGCGCGGCGGCGGCGGCGGCGGCCGAGGACTCGTTCGGCTCCTCGCACGACTGCT
CTTCGGGCACCTACTTCCCCGAGCAGTCGGACCTGGAGCCACCGCTGTTGGAGCTTGGCT
GGCCCGCCTTCTACCAGGGCGCCTACCGCGGCGCCACGCGTGTCGAGACGCACTTCCAGC
CCCGCGGCGCTGGCGAAGGTGGCCCCTACGGCTGCAAGGACGCTCTGCGCCAGCAGCTCC
GCTCGGCGCGAGAGGTGATTGCAGTGGTCATGGACGTGTTCACAGACATCGACATCTTCA
GAGACCTGCAAGAAATATGCAGGAAACAGGGAGTTGCTGTGTATATCCTTCTGGACCAGG
CTCTCCTCTCTCAATTTCTGGATATGTGCATGGATCTGAAAGTTCATCCTGAACAGGAAA
AGTTAATGACAGTTCGGACTATCACAGGAAATATCTACTATGCAAGGTCAGGAACTAAGA
TTATTGGGAAGGTTCACGAAAAGTTCACGTTGATTGATGGCATCCGCGTGGCAACAGGCT
CCTACAGTTTTACATGGACGGATGGCAAATTAAACAGCAGTAACTTGGTAATTCTGTCTG
GCCAAGTGGTTGAACACTTTGATCTGGAGTTCCGAATCCTGTATGCCCAGTCCAAGCCCA
TCAGCCCCAAACTCCTGTCTCACTTCCAGAGCAGCAACAAGTTTGATCACCTCACCAACC
GAAAACCACAGTCCAAGGAGCTCACCCTGGGCAACCTGCTGCGGATGCGGCTGGCTAGGC
TGTCAAGTACTCCCAGGAAGGCGGACCTGGACCCAGAGATGCCCGCAGAGGGCAAGGCAG
AGCGCAAGCCCCATGACTGTGAGTCCTCTACTGTTAGTGAGGAAGACTACTTCAGCAGCC
ACAGGGACGAGCTCCAGAGCAGAAAGGCCATTGACGCTGCCACTCAAACAGAGCCAGGAG
AGGAGATGCCAGGGCTGAGTGTGAGTGAGGTGGGAACACAAACCAGCATCACCACAGCAT
GTGCTGGTACCCAGACTGCAGTCATCACCAGGATAGCAAGCTCTCAAACCACGATTTGGT
CCAGATCGACCACTACTCAGACTGACATGGATGAGAACATTCTCTTTCCTCGAGGAACTC
AATCTACAGAAGGGTCACCAGTCTCAAAAATGTCTGTATCGAGATCTTCCAGTTTGAAGT
CTTCCTCCTCTGTGTCTTCCCAAGGCTCTGTGGCAAGCTCCACTGGTTCTCCCGCTTCCA
TCAGAACCACTGACTTCCACAATCCTGGCTATCCCAAGTACCTGGGCACCCCCCACCTGG
AACTGTACTTGAGTGACTCACTTAGAAACTTGAACAAAGAGCGGCAATTCCACTTCGCTG
GTATCAGGTCCCGGCTCAACCACATGCTGGCTATGCTGTCAAGGAGAACACTCTTTACTG
AAAACCACCTTGGCCTTCATTCTGGCAATTTCAGCAGAGTTAATTTGCTTGCTGTTAGAG
ATGTAGCACTTTATCCTTCCTATCAGTAACTGCTCCGTGTTCAGACTCCTGGTTTCTTCC
AGGCTTACAGTGGACATCATCAGCTTCCTGCTTTAAAAAATATCTTATGTCCCTAATTGC
CTTTCTTTTACCTGACTTTGTCACCTTTGTTGTCTTTGAATTCTTTAGGCTGCATATTAT
TTTACATGCTTTGTTTTGTCATGTATATACCAGGTATTGGTTTTATGGTTTAAACACTAT
GGATACAGGGGTTTGTTTTGCACAATTTTAATAGTCATGCACTACATAATGATGTTTTGG
TCAATGACAGACCACGTATATGTTGGCAGTCTCATAAGATTATAATACTGTATTTTTACT
ATACCTTTTCTGTGTTTAGATACAAATACCATTATGTTACAGTTGCCTACAGTATTCAGT
GCAGTAACATGATGTACAGGTTTGTAGCCTGTTTTGCATTTTTCTTAGGTTGTATGCTCT
TCTGTTTTAAAGGTTTGAATCACCAGCATTTTTGTGATCAAAATCCTATTTAGAAAAAAT
AAAACTACTTTCTGTTTATCTCTTTAGAAAAAAAAAAAAAAAAAA

Protein Sequence

>81610 : length: 615
MARACLIQRLPIKRDCTPVFVRGLSSPSAAMALLSEGLDEVPAACLSPCGPPNPTELFSE
SRRLALEELVAGGPEAFAAFLRRERLARFLNPDEVHAILRAAERPGEEGAAAAAAAEDSF
GSSHDCSSGTYFPEQSDLEPPLLELGWPAFYQGAYRGATRVETHFQPRGAGEGGPYGCKD
ALRQQLRSAREVIAVVMDVFTDIDIFRDLQEICRKQGVAVYILLDQALLSQFLDMCMDLK
VHPEQEKLMTVRTITGNIYYARSGTKIIGKVHEKFTLIDGIRVATGSYSFTWTDGKLNSS
NLVILSGQVVEHFDLEFRILYAQSKPISPKLLSHFQSSNKFDHLTNRKPQSKELTLGNLL
RMRLARLSSTPRKADLDPEMPAEGKAERKPHDCESSTVSEEDYFSSHRDELQSRKAIDAA
TQTEPGEEMPGLSVSEVGTQTSITTACAGTQTAVITRIASSQTTIWSRSTTTQTDMDENI
LFPRGTQSTEGSPVSKMSVSRSSSLKSSSSVSSQGSVASSTGSPASIRTTDFHNPGYPKY
LGTPHLELYLSDSLRNLNKERQFHFAGIRSRLNHMLAMLSRRTLFTENHLGLHSGNFSRV
NLLAVRDVALYPSYQ