ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

81608

Name

FIP1L1

Synonym

FIP1|Rhe|hFip1;factor interacting with PAPOLA and CPSF1;FIP1L1;factor interacting with PAPOLA and CPSF1

Definition

FIP1 like 1|FIP1-like 1 protein|FIP1L1 cleavage and polyadenylation specific factor subunit|factor interacting with PAP|pre-mRNA 3'-end-processing factor FIP1|rearranged in hypereosinophilia

Position

4q12

Gene Type

protein-coding

External Links

Links to cell senescence gene database

81608

Links to epithelial mesenchymal transition gene database

81608

Links to ovarian cancer gene database

81608

Links to endometrial cancer gene database

81608

Links to iHOP

81608

Sequence Information

Nucleotide Sequence

>81608 : length: 5165
ACCTGCGCTGGAGGCTTCATCTTTGCCGCCGCTGCCGTCGCCTTCCTGGGATTGGAGTCT
CGAGCTTTCTTCGTTCGTTCGTCGGCGGGTTCGCGCCCTTCTCGCGCCTCGGGGCTGCGA
GGCTGGGGAAGGGGTTGGAGGGGGCTGTTGATCGCCGCGTTTAAGTTGCGCTCGGGGCGG
CCATGTCGGCCGGCGAGGTCGAGCGCCTAGTGTCGGAGCTGAGCGGCGGGACCGGAGGGG
ATGAGGAGGAAGAGTGGCTCTATGGCGGCCCATGGGACGTGCATGTGCACAGTGATTTGG
CAAAGGACCTAGATGAAAATGAAGTTGAAAGGCCAGAAGAAGAAAATGCCAGTGCTAATC
CTCCATCTGGAATTGAAGATGAAACTGCTGAAAATGGTGTACCAAAACCGAAAGTGACTG
AGACCGAAGATGATAGTGATAGTGACAGCGATGATGATGAAGATGATGTTCATGTCACTA
TAGGAGACATTAAAACGGGAGCACCACAGTATGGGAGTTATGGTACAGCACCTGTAAATC
TTAACATCAAGACAGGGGGAAGAGTTTATGGAACTACAGGGACAAAAGTCAAAGGAGTAG
ACCTTGATGCACCTGGAAGCATTAATGGAGTTCCACTCTTAGAGGTAGATTTGGATTCTT
TTGAAGATAAACCATGGCGTAAACCTGGTGCTGATCTTTCTGATTATTTTAATTATGGGT
TTAATGAAGATACCTGGAAAGCTTACTGTGAAAAACAAAAGAGGATACGAATGGGACTTG
AAGTTATACCAGTAACCTCTACTACAAATAAAATTACGGCCGAAGACTGTACTATGGAAG
TTACACCAGGTGCAGAGATCCAAGATGGCAGATTCAATCTTTTTAAGGTACAGCAGGGAA
GAACTGGAAACTCAGAGAAAGAAACTGCCCTTCCATCTACAAAAGCTGAGTTTACTTCTC
CTCCTTCTTTGTTCAAGACTGGGCTTCCACCGAGCAGAAACAGCACTTCTTCTCAGTCTC
AGACAAGTACTGCCTCCAGAAAAGCCAATTCAAGCGTTGGGAAGTGGCAGGATCGATATG
GGAGGGCCGAATCACCTGATCTAAGGAGATTACCTGGGGCAATTGATGTTATCGGTCAGA
CTATAACTATCAGCCGAGTAGAAGGCAGGCGACGGGCAAATGAGAACAGCAACATACAGG
TCCTTTCTGAAAGATCTGCTACTGAAGTAGACAACAATTTTAGCAAACCACCTCCGTTTT
TCCCTCCAGGAGCTCCTCCCACTCACCTTCCACCTCCTCCATTTCTTCCACCTCCTCCGA
CTGTCAGCACTGCTCCACCTCTGATTCCACCACCGGGTATTCCAATAACTGTACCACCTC
CAGGTTTTCCTCCTCCACCAGGCGCTCCACCTCCATCTCTTATACCAACAATAGAAAGTG
GACATTCCTCTGGTTATGATAGTCGTTCTGCACGTGCATTTCCATATGGCAATGTTGCCT
TTCCCCATCTTCCTGGTTCTGCTCCTTCGTGGCCTAGTCTTGTGGACACCAGCAAGCAGT
GGGACTATTATGCCAGAAGAGAGAAAGACCGAGATAGAGAGAGAGACAGAGACAGAGAGC
GAGACCGTGATCGGGACAGAGAAAGAGAACGCACCAGAGAGAGAGAGAGGGAGCGTGATC
ACAGTCCTACACCAAGTGTTTTCAACAGGTTTGTTGGCGATGAAGAACGATACAGATACA
GGGAATATGCAGAAAGAGGTTATGAGCGTCACAGAGCAAGTCGAGAAAAAGAAGAACGAC
ATAGAGAAAGACGACACAGGGAGAAAGAGGAAACCAGACATAAGTCTTCTCGAAGTAATA
GTAGACGTCGCCATGAAAGTGAAGAAGGAGATAGTCACAGGAGACACAAACACAAAAAAT
CTAAAAGAAGCAAAGAAGGAAAAGAAGCGGGCAGTGAGCCTGCCCCTGAACAGGAGAGCA
CCGAAGCTACACCTGCAGAATAGGCATGGTTTTGGCCTTTTGTGTATATTAGTACCAGAA
GTAGATACTATAAATCTTGTTATTTTTCTGGATAATGTTTAAGAAATTTACCTTAAATCT
TGTTCTGTTTGTTAGTATGAAAAGTTAACTTTTTTTCCAAAATAAAAGAGTGAATTTTTC
ATGTTAAGTTAAAAATCTTTGTCTTGTACTATTTCAAAAATAAAAAGACAGCAATGACTT
TATATCCAAGAAAGGAATGTGAATGAGTCACTTAACAGGGAATCTAAAGAGCTGTGTTAG
CTGTGTACATACACAGATTATCTGAGAAAAGGTCAAGGGTTCCACTTGGGCCACAGTTTT
TTTGTTAATCAAACACCACTCTCTTAAGAGGCTGCATCACAAAAGGCAACAAAGGGCCCC
TCTAAGGCTTGAGATTAAAACTAGTCTTTATCATTACTGCTGTGACACTCTTGCTTAGTA
TATTAAGAGACTCATACATTTTTGATATCACAACTTTTTGATGGCTTTTCAATATTCTAA
ATTTGGGTTCCTGGTGAAACCAAATGGGGTACACTTTCATATCCAAATTAATAAAACCTA
TAAGGCATCTGGGTGGCCTCTATGAAATAAATTAATTAATTACCCATAGTGTAGTTTCTA
GGAGGCATGTGTACACACACTCTTCATTGTGGCACAAATTTAAATCGCCTCATGACCATG
TCTGTGAGCCAGGGTCAAGCTGGTTTGGCCTTCTTGATGCATTTTCCAAGGCCCACTGGT
GGAGCAGCATGAGTTTTTATACAGTTACTAACGATTGTGGAAAAAAAGAGCTTTAGCCAT
TTCTTACTAAAAACAAAACAAGTTTATAATTAATTCTCTGAGCGAGCATTTTTAGGGATA
AGCCTAGGAGGTATTCATCGGTGATGGTAACAAATAACATGGTATTTGAAAGAATAAATT
ACTAGGATCTTTTAAATAGTGATAATACAAAAGTAATCTTAATTAGTATCACATACTAAA
AGACAACTATAACTTCTGAAAAATATTTATTCTTGTTTGATGAAAGCAACGTTTCTCAGC
AATGCATTTTAAAAAATATTTTAGCTGTAAATTAAAAATGGCCATAATGTACCCTTGGCA
GACTTCAGCATATACCAAATTTTAAATTTAAATCAGCTTGAATTCAGTGGGGTATACAAA
TCATTTTAGTTGTTTTAGGGCTTTTTATTGAATAGAAAAAATATAAACAATGTTGTAGAG
TAATGAGAAATCCTCCACACTGAAAAAAAACTAGTAGTTTTAATTTTTTTGGAATCATAT
TTTCTGAGGTGTAACTGGCTTTCATTAGATGATCATACTTTTCCTGACATTTTTACAATG
TATTCTTTCTTTAAATATAAAAACTGACAAGATAAATATAGTGTTTCAACTTCTTAGCCT
ATTTGTGATTTTTCTGTTTTCCTCTGACCCATCATTGATTCTATAAAAAAGTGCCAGGCC
AAGAAACAATAGTTAGAGTAATTCTTCCTTTAAGTTCTTTCAGCAGTCTTGCCAAGCAAG
CATGTATCATTCCTGATGTACTTCTACCATTGACAGCAAGAAGAATATCACCACATCTAA
AAAAAAAAACAAAACAAGATATGATTAGTATTTTAATTCGTTGCTGAAGTTAATGCAAGT
TTATCTTAGTGGTGCTAGATTTTGCTACATCTGACCATTTTAATTATGTTAACTTCTAAT
TGAGATATTTCTTGCCTCTTATTTACATTCTCCAAACTCACTATCCATTCAGCTTGTGTT
AGAAGGAATGCTAAAAGTATGGGGAGTTGTAGTATGGGACCAAGAATATGTGTAATTATT
TTGGATTTCTCAGAAGTTGAATGCTACGTACATACTTTTAATCCCCACAAAGTATAATAA
ATACATGCCTTATCTCAAATGGGGCCAAGCTTTGGCATTTATGAAACAACATTTAATACA
AGTATTTTTGATTAGTCATTATTATTACCTAATTCTTCCATCATTGTATGCTGGTGTTCC
TTCAACAATGGATTTGATGAAAAAAGGTTTGTTTCCATTGTATTCTTCATAACCTCCTAC
AATGCAGAAGCCCAGACTTCCAGCTGTGTTTCTTCGTAATACAATATCTTTACAGTTATA
CAAGCACCTGAAATAGAATGTAATCAGTGTACATGCATATTTAAGTTTCACAGTTAAGGG
AATACTTACTGTGACTCATCCTCCATTCCTTTTGTTGGCATTTTTAATGGCTAAGTACCA
CTGCATAGGTCCCACTCAAAATTGTATCATACCTTGGTGACCTTTGTGCTGTTAGCTGGC
TTTTTGTAATTGAACCTGTTTTCCATAATTTTGAATATCCTTAAAAAACTGACAGCCCTA
TTGTGTTCTGTTACACATCTACTGGGAATGATAATCATATTTTTAACTTAAGACAATGCT
TGAATATGTATTAGCAAAAAGTTGGATAAACCTAAATCCTTATTGGTGAACAAACACACT
TATGGATGTCATATTTTTATTTACTTGATATAATTTTAATGAGGGCAAAAATCCTTTGAA
TAATCTCAATGAAAGCAGTTTAAGCCTAATCCTAATAAATGAATTCGTATACTTTTTTTG
ACCTTGGAAAAATACCACTTTACACCCAGTGCTACGTTTGATAAGTCATAGAGAAGCATG
CACGCATAAAGTGAATGGAAACAGAAACGTTTAAAGATTATAAGAACAATTCAAATAGGA
GGAAAAACAAACTGCAGGAAACTGGATAGGAAGTTATAAAAGGAATGGGAGAAGGAAAGG
CCCAGCTCTTCTGTAAATTAGAATCCTCAACTAAAATAGCAAATGAGATTGAAGAAATTT
TTATTCAGTGGCCCCCAATGGATCAGTGTTCATATAGGTACAGGCCAAGTGTTAACTATG
TTATAATTGCCATAGAAGTGTGTGTCAGGAGCTGAATTTTACTCCAGGATGACGTTGTTG
ACCACATTTGTAGCTGTAGTCCGGGAATTGGTTTGAAAGGAAATTGGCATTTTCATGTTG
CCAAAAATCAGATATGGCTATTTTGTTTATATACCGTACCTTAAAATATTAACTGCTTTT
TAGAAACCAATAAAAAGTCTTGTGAAATGTTAAATGATAAAGTTGATCATTACATTTGTT
ACCAA

Protein Sequence

>81608 : length: 606
MSAGEVERLVSELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENASANP
PSGIEDETAENGVPKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNL
NIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGF
NEDTWKAYCEKQKRIRMGLEVIPVTSTTNKITAEDCTMEVTPGAEIQDGRFNLFKVQQGR
TGNSEKETALPSTKAEFTSPPSLFKTGLPPSRNSTSSQSQTSTASRKANSSVGKWQDRYG
RAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFF
PPGAPPTHLPPPPFLPPPPTVSTAPPLIPPPGIPITVPPPGFPPPPGAPPPSLIPTIESG
HSSGYDSRSARAFPYGNVAFPHLPGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRER
DRDRDRERERTRERERERDHSPTPSVFNRFVGDEERYRYREYAERGYERHRASREKEERH
RERRHREKEETRHKSSRSNSRRRHESEEGDSHRRHKHKKSKRSKEGKEAGSEPAPEQEST
EATPAE