ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

81607

Name

PVRL4

Synonym

EDSS1|LNIR|PRR4|nectin-4;poliovirus receptor-related 4;PVRL4;poliovirus receptor-related 4

Definition

Ig superfamily receptor LNIR|nectin 4|nectin-4|poliovirus receptor-related protein 4

Position

1q23.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Nectin/Necl trans heterodimerization;PID Reactome;500121

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Cell junction organization;Reactome;REACT:20676

Disease

Ectodermal dysplasia-syndactyly syndrome 1;OMIM

External Links

Links to cell senescence gene database

81607

Links to epithelial mesenchymal transition gene database

81607

Links to ovarian cancer gene database

81607

Links to endometrial cancer gene database

81607

Links to iHOP

81607

Sequence Information

Nucleotide Sequence

>81607 : length: 3520
ACCTGTTCTGACCTGCTGAGCAGGTTCCCAGGTTTCTGCCGTCGTTGTTGGCCACAGCGT
GGGAAGCAGCTCTGGGGGAGCTCGGAGCTCCCGATCACGGCTTCTTGGGGGTAGCTACGG
CTGGGTGTGTAGAACGGGGCCGGGGCTGGGGCTGGGTCCCCTAGTGGAGACCCAAGTGCG
AGAGGCAAGAACTCTGCAGCTTCCTGCCTTCTGGGTCAGTTCCTTATTCAAGTCTGCAGC
CGGCTCCCAGGGAGATCTCGGTGGAACTTCAGAAACGCTGGGCAGTCTGCCTTTCAACCA
TGCCCCTGTCCCTGGGAGCCGAGATGTGGGGGCCTGAGGCCTGGCTGCTGCTGCTGCTAC
TGCTGGCATCATTTACAGGCCGGTGCCCCGCGGGTGAGCTGGAGACCTCAGACGTGGTAA
CTGTGGTGCTGGGCCAGGACGCAAAACTGCCCTGCTTCTACCGAGGGGACTCCGGCGAGC
AAGTGGGGCAAGTGGCATGGGCTCGGGTGGACGCGGGCGAAGGCGCCCAGGAACTAGCGC
TACTGCACTCCAAATACGGGCTTCATGTGAGCCCGGCTTACGAGGGCCGCGTGGAGCAGC
CGCCGCCCCCACGCAACCCCCTGGACGGCTCAGTGCTCCTGCGCAACGCAGTGCAGGCGG
ATGAGGGCGAGTACGAGTGCCGGGTCAGCACCTTCCCCGCCGGCAGCTTCCAGGCGCGGC
TGCGGCTCCGAGTGCTGGTGCCTCCCCTGCCCTCACTGAATCCTGGTCCAGCACTAGAAG
AGGGCCAGGGCCTGACCCTGGCAGCCTCCTGCACAGCTGAGGGCAGCCCAGCCCCCAGCG
TGACCTGGGACACGGAGGTCAAAGGCACAACGTCCAGCCGTTCCTTCAAGCACTCCCGCT
CTGCTGCCGTCACCTCAGAGTTCCACTTGGTGCCTAGCCGCAGCATGAATGGGCAGCCAC
TGACTTGTGTGGTGTCCCATCCTGGCCTGCTCCAGGACCAAAGGATCACCCACATCCTCC
ACGTGTCCTTCCTTGCTGAGGCCTCTGTGAGGGGCCTTGAAGACCAAAATCTGTGGCACA
TTGGCAGAGAAGGAGCTATGCTCAAGTGCCTGAGTGAAGGGCAGCCCCCTCCCTCATACA
ACTGGACACGGCTGGATGGGCCTCTGCCCAGTGGGGTACGAGTGGATGGGGACACTTTGG
GCTTTCCCCCACTGACCACTGAGCACAGCGGCATCTACGTCTGCCATGTCAGCAATGAGT
TCTCCTCAAGGGATTCTCAGGTCACTGTGGATGTTCTTGACCCCCAGGAAGACTCTGGGA
AGCAGGTGGACCTAGTGTCAGCCTCGGTGGTGGTGGTGGGTGTGATCGCCGCACTCTTGT
TCTGCCTTCTGGTGGTGGTGGTGGTGCTCATGTCCCGATACCATCGGCGCAAGGCCCAGC
AGATGACCCAGAAATATGAGGAGGAGCTGACCCTGACCAGGGAGAACTCCATCCGGAGGC
TGCATTCCCATCACACGGACCCCAGGAGCCAGCCGGAGGAGAGTGTAGGGCTGAGAGCCG
AGGGCCACCCTGATAGTCTCAAGGACAACAGTAGCTGCTCTGTGATGAGTGAAGAGCCCG
AGGGCCGCAGTTACTCCACGCTGACCACGGTGAGGGAGATAGAAACACAGACTGAACTGC
TGTCTCCAGGCTCTGGGCGGGCCGAGGAGGAGGAAGATCAGGATGAAGGCATCAAACAGG
CCATGAACCATTTTGTTCAGGAGAATGGGACCCTACGGGCCAAGCCCACGGGCAATGGCA
TCTACATCAATGGGCGGGGACACCTGGTCTGACCCAGGCCTGCCTCCCTTCCCTAGGCCT
GGCTCCTTCTGTTGACATGGGAGATTTTAGCTCATCTTGGGGGCCTCCTTAAACACCCCC
ATTTCTTGCGGAAGATGCTCCCCATCCCACTGACTGCTTGACCTTTACCTCCAACCCTTC
TGTTCATCGGGAGGGCTCCACCAATTGAGTCTCTCCCACCATGCATGCAGGTCACTGTGT
GTGTGCATGTGTGCCTGTGTGAGTGTTGACTGACTGTGTGTGTGTGGAGGGGTGACTGTC
CGTGGAGGGGTGACTGTGTCCGTGGTGTGTATTATGCTGTCATATCAGAGTCAAGTGAAC
TGTGGTGTATGTGCCACGGGATTTGAGTGGTTGCGTGGGCAACACTGTCAGGGTTTGGCG
TGTGTGTCATGTGGCTGTGTGTGACCTCTGCCTGAAAAAGCAGGTATTTTCTCAGACCCC
AGAGCAGTATTAATGATGCAGAGGTTGGAGGAGAGAGGTGGAGACTGTGGCTCAGACCCA
GGTGTGCGGGCATAGCTGGAGCTGGAATCTGCCTCCGGTGTGAGGGAACCTGTCTCCTAC
CACTTCGGAGCCATGGGGGCAAGTGTGAAGCAGCCAGTCCCTGGGTCAGCCAGAGGCTTG
AACTGTTACAGAAGCCCTCTGCCCTCTGGTGGCCTCTGGGCCTGCTGCATGTACATATTT
TCTGTAAATATACATGCGCCGGGAGCTTCTTGCAGGAATACTGCTCCGAATCACTTTTAA
TTTTTTTCTTTTTTTTTTCTTGCCCTTTCCATTAGTTGTATTTTTTATTTATTTTTATTT
TTATTTTTTTTTAGAGATGGAGTCTCACTATGTTGCTCAGGCTGGCCTTGAACTCCTGGG
CTCAAGCAATCCTCCTGCCTCAGCCTCCCTAGTAGCTGGGACTTTAAGTGTACACCACTG
TGCCTGCTTTGAATCCTTTACGAAGAGAAAAAAAAAATTAAAGAAAGCCTTTAGATTTAT
CCAATGTTTACTACTGGGATTGCTTAAAGTGAGGCCCCTCCAACACCAGGGGGTTAATTC
CTGTGATTGTGAAAGGGGCTACTTCCAAGGCATCTTCATGCAGGCAGCCCCTTGGGAGGG
CACCTGAGAGCTGGTAGAGTCTGAAATTAGGGATGTGAGCCTCGTGGTTACTGAGTAAGG
TAAAATTGCATCCACCATTGTTTGTGATACCTTAGGGAATTGCTTGGACCTGGTGACAAG
GGCTCCTGTTCAATAGTGGTGTTGGGGAGAGAGAGAGCAGTGATTATAGACCGAGAGAGT
AGGAGTTGAGGTGAGGTGAAGGAGGTGCTGGGGGTGAGAATGTCGCCTTTCCCCCTGGGT
TTTGGATCACTAATTCAAGGCTCTTCTGGATGTTTCTCTGGGTTGGGGCTGGAGTTCAAT
GAGGTTTATTTTTAGCTGGCCCACCCAGATACACTCAGCCAGAATACCTAGATTTAGTAC
CCAAACTCTTCTTAGTCTGAAATCTGCTGGATTTCTGGCCTAAGGGAGAGGCTCCCATCC
TTCGTTCCCCAGCCAGCCTAGGACTTCGAATGTGGAGCCTGAAGATCTAAGATCCTAACA
TGTACATTTTATGTAAATATGTGCATATTTGTACATAAAATGATATTCTGTTTTTAAATA
AACAGACAAAACTTGTTCTGTCAAAAAAAAAAAAAAAAAA

Protein Sequence

>81607 : length: 511
MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGE
QVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQA
DEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPS
VTWDTEVKGTTSSRSFKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHIL
HVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTL
GFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLADPQEDSGKQVDLVSASVVVVGVIAAL
LFCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLR
AEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIK
QAMNHFVQENGTLRAKPTGNGIYINGRGHLV