ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

81603

Name

TRIM8

Synonym

GERP|RNF27;tripartite motif containing 8;TRIM8;tripartite motif containing 8

Definition

glioblastoma expressed ring finger protein|glioblastoma-expressed RING finger protein|probable E3 ubiquitin-protein ligase TRIM8|ring finger protein 27|tripartite motif protein TRIM8|tripartite motif-containing 8|tripartite motif-containing protein 8

Position

10q24.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

81603

Links to epithelial mesenchymal transition gene database

81603

Links to ovarian cancer gene database

81603

Links to endometrial cancer gene database

81603

Links to iHOP

81603

Sequence Information

Nucleotide Sequence

>81603 : length: 4239
TTTATTAAACAGATTATTCCTGAAATAATAATACGCGCAAGATGGCTGAAGGTGGCTGTG
ATGAGAGTGTTGGGGTTGGGATTTTTTTCTTCCTGTTTTTTCTTTTTTGATCTGAGGATA
AAGCTCTGAGGCGACAGCGGCTGCGGAGACCCTGCCCGAAGCGCCCTCCCCTCCCTTGAG
AAGCCGCGGGCAGACAGACGGACCTCGGACCGAGCAACGGGTGCGGGCCCGCCCCGGACG
CGTCGCCTGGGCAGCAGCCGGGGACCGCGGGCTCTCGCCTTTCTGCCGACTTCTTCCAAT
TCTCATCTTCTTTTATTTTTTGGACAGGACCGGGGTGGGTGGAGCAGAGGTGGAGAGAAA
TCGGGACTTGGCATTTTCTCCCTCTCTCTCTCCTAATTTGTTGGAGGCCGCCAGCCCTCC
CCTTGGAAAAAAAAAAATCCCACCAAAAAAAAAAAAAAAAGAATCAGGAGCGAGAGGACG
CCGCGGGGCCCTCAGCGAGCGCGCCCAGACCCCGGCCGCCGCCGCGGAGCCCAAGATGGC
TGGGCGCTGAGGGTGGCGGCTCGGCCTGGCCCCGCCGCCGCAGGCTGGCTCCGACCGCAG
CCCCGAGCCTTCCAGGCCCCAGCAGAGGCCGAGAAGAAAAGAAAGTGGGGAGGAGGGGGC
CGGGGGGGCGAAGGGGGAGGGCCGGGGGAGGGGAGGGGAGGGCCGGGAGCCGAGCCTCCT
GTTCATTAGCAGTTGAGAAAAATTCCTTTCTAGTTTGATCAATCCTTGTTTTCCTCGGCA
GAGCCCGGGCGCCCGCCCAGCGCGGAGACGGGCGCGCGGGGTCTCTCCGCGGCGGGGGCG
CCGGGCCTCGGGGGAGCGCAGAAGTAGCCGCCCGGGGGTCAGGCCGGAGCGCCGCCGGGG
CTTCTCCCTCCCTCCCTCGCCGGTTGCCTTTTTTTCCACTTCTCTCCCTCCCCCTTCCGT
TTCTATTTGTGAAGGGAGGAGGAAGGCAGAGGCGGGCTGGTGTCTCTGGCCGGGGACTGG
AATTTCATCTGAATGACTGCCCCTGCGCGCACGCAGCGCCCCGGAGTCGGCCCGCCCGCG
CCCCGCAGCCCGCGCCCGGCCAGCCAGCCGGGGGACGCCTGCACCGTGGCCCGGGGACCG
CCGGCCTGCCCCTCCCGCCCCGTCCGGATCTAGCAGCCCTCGGCGCGGCCGCCCTCGCCT
CCTGGCCCCGCAGACCCCGGGCTCCGGCCCCTGCGAGGGAGGTGCGGCGCCGACGAGCCA
GGCAGGAGCCGCCGCTGCCGCCGCCGCCGGAAGAAGTGTGCTGCTCCCAAGCTCCGTCTG
CCGCGGGGCGCGCCCCAATGTCAGCCGCGGGGACGAGCGCAGGCCGCGGGCCGCCACTGC
CCTAGCCGCGCCGACGGGGAGGCGGCCTCTTATATGGAATTTGGACCCCGGCGCTCCCCT
CCAAGGCTGGAGTCCCGGCCGCGGCCCTGGCGCAGTCCGCCGCCTCCCGCTAGGCGCTCG
GGAGGAGGAGGAGACGCAGCCCGCTGCGCGCGCGGCGTGAGGACCGCGGCTCCCTCCTCC
GGGGGGCGGGCACGCGGAAGGCGCTGCTGACTGAGCGACCGTCGGGGCCGGCTGGGGCCG
GAGCTCGGGGCTCGGTGGGCCTACAGCGGCTCCGGACGGACCCCCGGGGCTGGGGAGTCG
GGGAGGCCTGCCCCGGCCCCCTGCCCGCGGCCGCCATGGCGGAGAATTGGAAGAACTGCT
TCGAGGAGGAGCTCATCTGCCCTATCTGCCTGCACGTTTTCGTGGAGCCAGTGCAGCTGC
CGTGCAAACACAACTTCTGCCGGGGCTGCATCGGCGAGGCGTGGGCCAAGGACAGCGGCC
TCGTACGCTGCCCAGAGTGCAACCAGGCCTACAACCAGAAGCCGGGCCTGGAGAAGAACC
TGAAGCTCACCAACATCGTGGAGAAGTTCAATGCCCTGCACGTGGAGAAGCCGCCGGCGG
CGCTGCACTGCGTGTTCTGCCGCCGCGGCCCCCCGCTGCCCGCGCAGAAGGTCTGCCTGC
GCTGCGAGGCGCCCTGCTGCCAGTCCCACGTGCAGACGCACCTGCAGCAGCCCTCCACCG
CCCGCGGGCACCTCCTGGTGGAGGCGGACGACGTGCGGGCCTGGAGCTGCCCGCAGCACA
ACGCCTACCGCCTCTACCACTGCGAGGCCGAGCAGGTGGCCGTGTGCCAGTACTGCTGCT
ACTACAGCGGCGCGCATCAGGGACACTCGGTGTGCGACGTGGAGATCCGAAGGAATGAAA
TCCGGGAGAAAGTGAACCAACTGAAGGAGGAAGTTCGGCTGCAGTACGAGAAGCTGCACC
AGCTGCTGGACGAGGACCTGCGGCAGACAGTGGAGGTCCTAGACAAGGCCCAGGCCAAGT
TCTGCAGCGAGAACGCAGCGCAGGCGCTGCACCTCGGGGAGCGCATGCAGGAGGCCAAGA
AGCTGCTGGGCTCCCTGCAGCTGCTCTTTGATAAGACGGAGGATGTCAGCTTCATGAAGA
ACACCAAGTCTGTGAAAATCCTGATGGACAGGACCCAGACCTGCACGAGCAGCAGCCTTT
CCCCCACTAAGATCGGCCACCTGAACTCCAAGCTCTTCCTGAACGAAGTGGCCAAGAAGG
AGAAGCAGCTGCGGAAAATGCTAGAAGGCCCCTTCAGCACGCCGGTGCCCTTCCTGCAGA
GTGTCCCCCTGTACCCTTGCGGCGTGAGCAGCTCTGGGGCGGAAAAGCGCAAGCACTCAA
CGGCCTTCCCAGAGGCCAGTTTCCTAGAGACGTCGTCGGGCCCTGTGGGCGGCCAGTACG
GGGCGGCGGGCACAGCCAGCGGTGAGGGCCAGTCTGGGCAGCCCCTGGGGCCCTGCAGCT
CCACGCAGCACTTGGTGGCCCTGCCGGGCGGCGCCCAACCAGTGCACTCAAGCCCCGTGT
TCCCCCCATCGCAGTATCCCAATGGCTCCGCCGCCCAGCAGCCCATGCTCCCCCAGTATG
GCGGCCGCAAGATTCTCGTCTGTTCTGTGGACAACTGTTACTGTTCTTCCGTGGCCAACC
ATGGCGGCCACCAGCCCTACCCCCGCTCCGGCCACTTTCCCTGGACAGTGCCCTCGCAGG
AGTACTCACACCCGCTCCCGCCCACACCCTCCGTCCCCCAGTCCCTTCCCAGCCTGGCGG
TCAGAGACTGGCTTGACGCCTCCCAGCAGCCCGGCCACCAGGATTTCTACAGGGTGTATG
GGCAGCCGTCCACCAAACACTACGTGACGAGCTAACGCCACGCAGGCGGCGGGGCGCTGG
GGAATCTTCCTCCCCAGCCCCCGGGCTCGGGAGTTATGCATCCAGAGACCTGCCCTTCTA
CCTTCCTCGCCTCCCCTCTTCCTCATTCCATTGCCCCAGGTCTTTTCCTTTTGGATTTTG
TTTTGGTTTTGGCTTTGTTTTTGATTTTTTTTTATTATGAATCTCCTGGACGCAGAGGTG
ACAGTGGGAGCTGGCCTGGGCCAGGACGGCAGGTGGCCCTGGAGATGGGAAAGTGTCTGT
GTCGAGGCGCTGAGCTCTCTCTCTGTTTCTCCTTTTTTCCTCTACTCCTTCCCCTTCACA
CCCCCGTGGCTGGAAGGAACCTCGGCTTCCCTGAAAGCTTGGGGGTCCCACCCTTCTTAC
CCCACCCGGGAGGAACGCCCAGGGCCCCGGGCTTGTTTCTCCTCTTGTTTTCCTTTTGGG
CAGTTTGATCACTGATCGAGTAAGGAATGACCTTTAGATTGTGCGACTTTTGTTTTTGTT
TTTTTAAATTTTTTTAAACCAAGAATGATTTCTCCTGCTTCCTTCTCCTCACCATCTTCC
CAGACGGAGTTCAAAGGCCACTTCTCAAGCAGCTTTTGGCACCTTCAGCCTCAGAGTGGA
ATCTTTTAAAGACAGGACCCCTATGTCCAGGAAAGGGGAAAAGGAACTTTGCCAATGATA
GTGACCACAGCAAAAGCAAATAATAATAATATTAATAATAATAAAGAGAAATAAAATAAT
AAAATAAAAAACAATAGCACAGCCCTTGTTGAGGTCAGCAGGGAGGAGGGGCTGCCCGGA
GTTGGGTCCTTGCCTGGATTTTGACACAGCAACTTCCTGTAGTGAGCACTTTGTATGAAT
CGTGGACTTCCTGTTCTCAAGGCGCAGGTATTTATTCTGTATCTGTCTAGAGCACACACC
AAAATCCAACCTTCTAATAAACATGATGGCGCAGTCCCA

Protein Sequence

>81603 : length: 551
MAENWKNCFEEELICPICLHVFVEPVQLPCKHNFCRGCIGEAWAKDSGLVRCPECNQAYN
QKPGLEKNLKLTNIVEKFNALHVEKPPAALHCVFCRRGPPLPAQKVCLRCEAPCCQSHVQ
THLQQPSTARGHLLVEADDVRAWSCPQHNAYRLYHCEAEQVAVCQYCCYYSGAHQGHSVC
DVEIRRNEIRKMLMKQQDRLEEREQDIEDQLYKLESDKRLVEEKVNQLKEEVRLQYEKLH
QLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGSLQLLFDKTEDVSFMK
NTKSVKILMDRTQTCTSSSLSPTKIGHLNSKLFLNEVAKKEKQLRKMLEGPFSTPVPFLQ
SVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASGEGQSGQPLGPCS
STQHLVALPGGAQPVHSSPVFPPSQYPNGSAAQQPMLPQYGGRKILVCSVDNCYCSSVAN
HGGHQPYPRSGHFPWTVPSQEYSHPLPPTPSVPQSLPSLAVRDWLDASQQPGHQDFYRVY
GQPSTKHYVTS