ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8148

Name

TAF15

Synonym

Npl3|RBP56|TAF2N|TAFII68;TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa;TAF15;TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa

Definition

RBP56/CSMF fusion|TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD (RNA-binding protein 56)|TATA box-binding protein-associated factor 2N (RNA-binding protein 56)|TATA-binding protein-associated factor 2N|TBP-associated factor

Position

17q11.1-q11.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

8148

Links to epithelial mesenchymal transition gene database

8148

Links to ovarian cancer gene database

8148

Links to endometrial cancer gene database

8148

Links to iHOP

8148

Sequence Information

Nucleotide Sequence

>8148 : length: 2217
AGTCCGCCTCAGCCCGCCGCGCCGCCCTCAGTACAGCTCCGGCCGCCGCGCCGCCTGGCT
TTCGTATTCGTTGTTCTCGGCGGGCTGTGGGGCCTCCGCGCCGCGGCCGTTAGTCATGTC
GGATTCTGGAAGTTACGGTCAGTCTGGGGGTGAGCAGCAAAGTTATTCTACCTATGGAAA
TCCAGGCAGCCAAGGCTATGGACAAGCATCACAAAGCTATTCTGGCTATGGGCAAACGAC
TGATTCCTCTTATGGACAGAACTACAGCGGTTACTCCAGTTATGGACAAAGTCAGTCAGG
TTATTCACAGTCCTATGGTGGTTATGAGAATCAAAAGCAGAGCTCATATAGCCAGCAACC
ATATAATAACCAGGGACAGCAGCAAAACATGGAATCATCAGGAAGCCAAGGTGGAAGAGC
ACCTTCCTATGACCAGCCAGACTATGGTCAACAAGATTCATATGACCAGCAGTCAGGCTA
TGATCAACATCAAGGCTCATATGATGAGCAGTCAAATTATGATCAGCAGCATGATTCCTA
TAGTCAAAACCAGCAGTCCTATCATTCACAAAGGGAAAACTACAGCCACCACACACAAGA
TGACCGTCGTGATGTGAGTAGGTATGGAGAAGATAATAGAGGATATGGCGGGTCACAGGG
AGGAGGTAGAGGGCGTGGGGGATATGACAAGGATGGAAGAGGTCCTATGACAGGATCAAG
TGGTGGTGACCGCGGTGGCTTCAAAAATTTTGGTGGTCACAGGGATTATGGACCCAGAAC
AGATGCTGATTCAGAATCTGATAATTCAGATAACAACACAATCTTTGTGCAAGGACTTGG
GGAGGGTGTGTCTACAGATCAAGTTGGGGAGTTCTTTAAACAAATAGGAATTATCAAGAC
AAATAAGAAGACCGGAAAACCAATGATAAATCTTTATACAGACAAGGACACAGGAAAGCC
AAAGGGGGAGGCAACAGTGTCATTTGATGACCCTCCTTCAGCTAAGGCAGCCATTGACTG
GTTTGATGGAAAAGAATTCCATGGCAACATCATTAAAGTGTCCTTTGCCACTAGAAGACC
TGAATTCATGAGAGGAGGTGGAAGTGGAGGTGGGCGGCGAGGCCGTGGAGGATATAGAGG
TCGTGGAGGCTTTCAAGGGAGAGGTGGAGACCCCAAAAGTGGGGATTGGGTTTGCCCTAA
TCCGTCATGCGGAAATATGAACTTTGCTCGAAGGAATTCCTGCAATCAGTGCAATGAGCC
TAGACCAGAGGACTCTCGTCCCTCAGGAGGAGATTTCCGGGGGAGAGGCTACGGTGGAGA
GAGGGGCTACAGAGGTCGTGGGGGCAGAGGTGGAGACCGAGGCGGCTATGGTGGAGACAG
AAGTGGGGGTGGCTATGGTGGAGACAGAAGCAGCGGTGGTGGCTACAGCGGAGATAGAAG
TGGGGGCGGCTATGGTGGAGACAGAAGTGGGGGTGGCTATGGTGGGGACAGAGGCGGCGG
CTATGGTGGGGACAGAGGAGGCGGCTATGGAGGAGACCGAGGAGGTGGCTATGGAGGAGA
TCGAGGTGGCTATGGAGGAGACCGAGGTGGAGGCTATGGTGGAGACCGAGGAGGCTATGG
AGGAGATCGAGGAGGTTACGGAGGAGATCGAGGAGGTTATGGAGGAGATCGAGGAGGCTA
TGGAGGAGACAGAAGCCGGGGGGGCTATGGAGGAGACCGTGGTGGTGGCAGTGGCTACGG
TGGAGACCGAAGTGGAGGCTATGGAGGAGACAGGAGTGGTGGCGGCTATGGAGGAGACCG
AGGTGGGGGCTACGGAGGAGACCGAGGTGGCTATGGAGGCAAAATGGGAGGAAGAAACGA
CTACAGAAATGATCAGCGCAACCGACCATACTGATGACTGTTTTGAATGTTCCTTTGTCT
CTGACATGATCCATAGTGAAATTGCCAGAGTTTTGCCTGCTGCTTTCCTCGTGGCCTCTT
CTTGGGTAGTGAAATTAAGTGACATTTGGATTTTTATTTGGGTGGGAGGGCTGGGACAGT
TTTTCTTCTAGAAATGTCTGTTGAGATTTCCCCCTTTAGTTTCCAACCTTCTCCCCAACC
CTTGGAGCTAAATGCGTTGTAAAATATTGCCAAAATGAAAAGTGTTTTGTAATACTGCAA
TAAAGGCTGCTTGTTTTTGTGGACTTTTGTAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>8148 : length: 592
MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQ
SGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQS
GYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGS
QGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQG
LGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPKGEATVSFDDPPSAKAAI
DWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVC
PNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGG
DRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYG
GDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSG
YGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY