ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8115

Name

TCL1A

Synonym

TCL1;T-cell leukemia/lymphoma 1A;TCL1A;T-cell leukemia/lymphoma 1A

Definition

T-cell leukemia/lymphoma protein 1A|T-cell lymphoma-1|oncogene TCL-1|oncogene TCL1|protein p14 TCL1

Position

14q32.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

8115

Links to epithelial mesenchymal transition gene database

8115

Links to ovarian cancer gene database

8115

Links to endometrial cancer gene database

8115

Links to iHOP

8115

Sequence Information

Nucleotide Sequence

>8115 : length: 1634
GTCCTCCCGCCCCGCCGCTTGGTGGCGGCCGCATGCTGCCCGGATATAAAGGGTCGGCCC
CACATCCCAGGGACCAGCGAGCGGCCTTGAGAGGCTCTGGCTCTTGCTTCTTAGGCGGCC
CGAGGACGCCATGGCCGAGTGCCCGACACTCGGGGAGGCAGTCACCGACCACCCGGACCG
CCTGTGGGCCTGGGAGAAGTTCGTGTATTTGGACGAGAAGCAGCACGCCTGGCTGCCCTT
AACCATCGAGATACAGGGTCTCGCTCTGTGACCCAGGCTGGTCTTAAACTCCTGGCCTCA
AGCGATCCTCCTGCCTCTGCCTTCCAAAGCACTGGAATTACAAGTGTGAGCCGCTGCAAC
CCGCCAGAAAAAAGTGTGCCTTTCATGGCCCTGTCTGGGTGGCTAGACACGTGTGTGTGC
TGGTGGTCCTGGCCCAGCCAGAGTCCCTGAGAGGAGCATGCATGGCCTAAGGAAATAAAG
GATAGGTTACAGTTACGGGTGCTCTTGCGTCGGGAAGACGTCGTCCTGGGGAGGCCTATG
ACCCCCACCCAGATAGGCCCAAGCCTGCTGCCTATCATGTGGCAGCTCTACCCTGATGGA
CGATACCGATCCTCAGACTCCAGTTTCTGGCGCTTAGTGTACCACATCAAGATTGACGGC
GTGGAGGACATGCTTCTCGAGCTGCTGCCAGATGACTGATGTATGGTCTTGGCAGCACCT
GTCTCCTTTCACCCCAGGGCCTGAGCCTGGCCAGCCTACAATGGGGATGTTGTGTTTCTG
TTCACCTTCGTTTACTATGCCTGTGTCTTCTCCACCACGCTGGGGTCTGGGAGGAATGGA
CAGACAGAGGATGAGCTCTACCCAGGGCCTGCAGGACCTGCCTGTAGCCCACTCTGCTCG
CCTTAGCACTACCACTCCTGCCAAGGAGGATTCCATTTGGCAGAGCTTCTTCCAGGTGCC
CAGCTATACCTGTGCCTCGGCTTTTCTCAGCTGGATGATGGTCTTCAGCCTCTTTCTGTC
CCTTCTGTCCCTCACAGCACTAGTATTTCATGTTGCACACCCACTCAGCTCCGTGAACTT
GTGAGAACACAGCCGATTCACCTGAGCAGGACCTCTGAAACCCTGGACCAGTGGTCTCAC
ATGGTGCTACGCCTGCATGTAAACACGCCTGCAAACGCTGCCTGCCGGTAAACACGCCTG
CAAACGCTGCCTGCCCGTAAACACGCCTGCAAACGCTGCCTGCCCACACAGGTTCACGTG
CAGCTCAAGGAAAGGCCTGAAAGGAGCCCTTATCTGTGCTCAGGACTCAGAAGCCTCTGG
GTCAGTGGTCCACATCCCGGGACGCAGCAGGAGGCCAGGCCGGCGAGCCCTGTGGATGAG
CCCTCAGAACCCTTGGCTTGCCCACGTGGAAAAGGGATAGAGGTTGGGTTTCCCCCCTTT
TATAGATGGTCACGCACCTGGGTGTTACAAAGTTGTATGTGGCATGAATACTTTTTGTAA
TGATTGATTAAATGCAAGATAGTTTATCTAACTTCGTGCGGAATCAGCTTCTATCCTTGA
CTTAGATTCTGGTGGAGAGAAGTGAGAATAGGCAGCCCCCAAATAAAAAATATTCATGGA
AAAAAAAAAAAAAA

Protein Sequence

>8115 : length: 114
MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGR
PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD