ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

81

Name

ACTN4

Synonym

ACTININ-4|FSGS|FSGS1;actinin, alpha 4;ACTN4;actinin, alpha 4

Definition

F-actin cross-linking protein|actinin alpha4 isoform|alpha-actinin-4|focal segmental glomerulosclerosis 1|non-muscle alpha-actinin 4

Position

19q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Interactions of the immunoglobulin superfamily (IgSF) member proteins;Reactome;REACT:23853

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Arrhythmogenic right ventricular cardiomyopathy (ARVC);KEGG PATHWAY;hsa05412

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Systemic lupus erythematosus;KEGG PATHWAY;hsa05322

Disease

Proteinuria;FunDO

Disease

Breast cancer;FunDO

Disease

Glomerulosclerosis, focal segmental, 1;OMIM

Disease

Pancreas disease;FunDO

Disease

Ovarian disease;FunDO

External Links

Links to cell senescence gene database

81

Links to epithelial mesenchymal transition gene database

81

Links to ovarian cancer gene database

81

Links to endometrial cancer gene database

81

Links to iHOP

81

Sequence Information

Nucleotide Sequence

>81 : length: 3966
AGGCGCGGGCGGAGGGCGGGCTGAAGCAGCTGAAGCGGCGGTAGCGGCGGCGGCTCGGGC
AGAGGGGCGGGAGCTGAGGCGGGAGCGGACAGGCTGGTGGGCGAGCGAGAGGCGGCGGAA
TGGTGGACTACCACGCGGCGAACCAGTCGTACCAGTACGGCCCCAGCAGCGCGGGCAATG
GCGCTGGCGGCGGGGGCAGCATGGGCGACTACATGGCCCAGGAGGACGACTGGGACCGGG
ACCTGCTGCTGGACCCGGCCTGGGAGAAGCAGCAGCGCAAGACCTTCACGGCATGGTGCA
ACTCCCACCTGCGGAAGGCAGGCACACAGATCGAGAACATTGATGAGGACTTCCGAGACG
GGCTCAAGCTCATGCTGCTCCTGGAGGTCATATCAGGGGAGCGGTTACCTAAGCCGGAGC
GGGGGAAGATGAGAGTGCACAAAATCAACAATGTGAACAAAGCGCTGGACTTTATTGCCA
GCAAAGGCGTCAAGCTGGTCTCCATCGGGGCAGAAGAGATTGTGGACGGCAACGCAAAGA
TGACCCTGGGAATGATCTGGACCATCATCCTTAGGTTCGCCATCCAGGACATCTCCGTGG
AAGAGACCTCGGCCAAGGAAGGGCTCCTTCTCTGGTGCCAGAGAAAGACAGCCCCGTATA
AGAACGTCAATGTGCAGAACTTCCACATCAGCTGGAAGGATGGTCTTGCCTTCAATGCCC
TGATCCACCGGCACAGACCAGAGCTGATTGAGTATGACAAGCTGAGGAAGGACGACCCTG
TCACCAACCTGAACAATGCCTTCGAAGTGGCTGAGAAATACCTCGACATCCCCAAGATGC
TGGATGCAGAGGACATCGTGAACACGGCCCGGCCCGACGAGAAGGCCATAATGACCTATG
TGTCCAGCTTCTACCATGCCTTTTCAGGAGCGCAGAAGGCTGAAACTGCCGCCAACCGGA
TCTGTAAGGTGCTGGCTGTCAACCAAGAGAACGAGCACCTGATGGAGGACTACGAGAAGC
TGGCCAGCGACCTCCTGGAGTGGATCCGGCGCACCATCCCCTGGCTGGAGGACCGTGTGC
CCCAAAAGACTATCCAGGAGATGCAGCAGAAGCTGGAGGACTTCCGCGACTACCGGCGTG
TGCACAAGCCGCCCAAGGTGCAGGAGAAGTGCCAGCTGGAGATCAACTTCAACACGCTGC
AGACCAAGCTGCGCCTCAGCAACCGGCCCGCCTTCATGCCCTCCGAGGGCAAGATGGTCT
CGGACATCAACAATGGCTGGCAGCACTTGGAGCAGGCTGAGAAGGGCTACGAGGAGTGGC
TGCTGAATGAGATCCGCAGGCTGGAGCGGCTCGACCACCTGGCAGAGAAGTTCCGGCAGA
AGGCCTCCATCCACGAGGCCTGGACTGACGGGAAGGAAGCCATGCTGAAGCACCGGGACT
ACGAGACGGCCACACTATCGGACATCAAAGCCCTCATTCGCAAGCACGAGGCCTTCGAGA
GCGACCTGGCTGCGCACCAGGACCGCGTGGAGCAGATCGCCGCCATTGCCCAGGAGCTCA
ACGAGCTGGATTACTACGACTCCCACAATGTCAACACCCGGTGCCAGAAGATCTGTGACC
AGTGGGACGCCCTCGGCTCTCTGACACATAGTCGCAGGGAAGCCCTGGAGAAAACAGAGA
AGCAGCTGGAGGCCATCGACCAGCTGCACCTGGAATACGCCAAGCGCGCGGCCCCCTTCA
ACAACTGGATGGAGAGCGCCATGGAGGACCTCCAGGACATGTTCATCGTCCATACCATCG
AGGAGATTGAGGGCCTGATCTCAGCCCATGACCAGTTCAAGTCCACCCTGCCGGACGCCG
ATAGGGAGCGCGAGGCCATCCTGGCCATCCACAAGGAGGCCCAGAGGATCGCTGAGAGCA
ACCACATCAAGCTGTCGGGCAGCAACCCCTACACCACCGTCACCCCGCAAATCATCAACT
CCAAGTGGGAGAAGGTGCAGCAGCTGGTGCCAAAACGGGACCATGCCCTCCTGGAGGAGC
AGAGCAAGCAGCAGTCCAACGAGCACCTGCGCCGCCAGTTCGCCAGCCAGGCCAATGTTG
TGGGGCCCTGGATCCAGACCAAGATGGAGGAGATCGGGCGCATCTCCATTGAGATGAACG
GGACCCTGGAGGACCAGCTGAGCCACCTGAAGCAGTATGAACGCAGCATCGTGGACTACA
AGCCCAACCTGGACCTGCTGGAGCAGCAGCACCAGCTCATCCAGGAGGCCCTCATCTTCG
ACAACAAGCACACCAACTATACCATGGAGCACATCCGCGTGGGCTGGGAGCAGCTGCTCA
CCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGG
GCATCAGCCAGGAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATC
ATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCCTGGGCTACGACG
TGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCA
ACCATAGCGGCCTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCG
ACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAGGGGACAAGAACT
TCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCG
CCCGCATGGCGCCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCT
TCTCCACGGCCTTGTATGGCGAGAGCGACCTGTGAGGCCCCAGAGACCTGACCCAACACC
CCCGACGGCCTCCAGGAGGGGCCTGGGCAGCCCCACAGTCCCATTCCTCCACTCTGTATC
TATGCAAAGCACTCTCTGCAGTCCTCCGGGGTGGGTGGGTGGGCAGGGAGGGGCTGGGGC
AGGCTCTCTCCTCTCTCTCTTTGTGGGTTGGCCAGGAGGTTCCCCCGACCAGGTTGGGGA
GACTTGGGGCCAGCGCTTCTGGTCTGGTAAATATGTATGATGTGTTGTGCTTTTTTAACC
AAGGAGGGGCCAGTGGATTCCCACAGCACAACCGGTCCCTTCCATGCCCTGGGATGCCTC
ACCACACCCAGGTCTCTTCCTTTGCTCTGAGGTCCCTTCAAGGCCTCCCCAATCCAGGCC
AAAGCCCCATGTGCCTTGTCCAGGAACTGCCTGGGCCATGCGAGGGGCCAGCAGAGGGCG
CCACCACCACCTGACGGCTGGGGACCCACCCAGCCCCTCTCCCCTCTCTGCTCCAGACTC
ACTTGCCATTGCCAGGAGATGGCCCCAACAAGCACCCCGCTTTTGCAGCAGAGGAGCTGA
GTTGGCAGACCGGGCCCCCCTGAACCGCACCCCATCCCACCAGCCCCGGCCTTGCTTTGT
CTGGCCTCACGTGTCTCAGATTTTCTAAGAACCAAAAAAAAAAAAGGAAAAAAAACACAA
AACAACAAAAACCAAAAAAAAAAAAAATCACAAAAACAAAAAAACTATAAAAAAGAAAGA
ATTAAAAACTTTCAGAGAATTACTATTTACTTTATTAACTTACGGATTTATTATATAAAT
ATATATTCACCTAGCAACATATCTCTGCCGTCTCTCCTGCTCTCATAATGAAGACATAGC
CGATTCTCTGCCCGGGCCCCTTGCTGATGCTCCTCCGGGTCTGCGTCGGGCGTGGGTCTC
TGGGGACCCTCCAGAGGTGGAGGTGGGCTGATGGCCTGGCTGCCTGGTGGTTGATGGTTT
TGCTCCCCCTACCTTTTTTTTTTGAGTTTATTCTGATTGATTTTTTTTCTTGGTTTCTGG
ATAAACCACCCTCTGGGGACAGGATAATAAAACATGTAATATTTTTAAGAAGGAAAAAAA
AAAAAA

Protein Sequence

>81 : length: 911
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWC
NSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIA
SKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPY
KNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM
LDAEDIVGTLRPDEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEK
LASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTL
QTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ
KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL
NELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPF
NNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAES
NHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANV
VGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF
DNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKD
HGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETT
DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKS
FSTALYGESDL