ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8089

Name

YEATS4

Synonym

4930573H17Rik|B230215M10Rik|GAS41|NUBI-1|YAF9;YEATS domain containing 4;YEATS4;YEATS domain containing 4

Definition

NuMA binding protein 1|YEATS domain-containing protein 4|glioma-amplified sequence 41|glioma-amplified sequence-41|nuBI1|nuMA-binding protein 1

Position

12q13-q15

Gene Type

protein-coding

Pathways and Diseases

Pathway

C-MYB transcription factor network;PID Curated;200130

Disease

response to diuretic therapy;GAD

Disease

PHARMACOGENOMIC;GAD

Disease

DEVELOPMENTAL;GAD

Disease

height;GAD

External Links

Links to cell senescence gene database

8089

Links to epithelial mesenchymal transition gene database

8089

Links to ovarian cancer gene database

8089

Links to endometrial cancer gene database

8089

Links to iHOP

8089

Sequence Information

Nucleotide Sequence

>8089 : length: 1740
ATACGCGAGCCCGTTGCGCCTGCGCGCGGTGCGGCCGTCGCCCCTCTTTTCGCGGCGTTC
TCCACCTGCGCGGGCCTGAATGGCCTTCAGGAGCACAGTCGGCCTGAGGAGTTGACGGTT
ACTCACCGCCGTGAGCCCAAGTAACTCGCCCTCCTTCGGCTAGAAACCCTCCGCCTGGGC
CCGCGCGACAGGAGCGCGGTCTCTGAGGGGAGCGGCGACCCCGCCAGCCCCGGTCTCTTT
CCCTGGCGGCGGCGGCTTCTTCCGTGGGACAATATGTTCAAGAGAATGGCCGAATTTGGG
CCTGACTCCGGCGGGAGAGTAAAGGGTGTTACTATCGTTAAACCAATAGTTTACGGTAAT
GTTGCTCGGTATTTTGGAAAGAAAAGAGAAGAAGATGGGCACACTCATCAGTGGACAGTA
TATGTGAAACCATATAGAAATGAGGATATGTCAGCATATGTGAAGAAAATCCAGTTTAAA
TTACATGAAAGCTATGGCAATCCTTTAAGAGTTGTTACTAAACCTCCATATGAAATTACT
GAAACAGGATGGGGTGAATTCGAAATAATCATCAAAATATTTTTCATTGACCCTAATGAA
AGACCTGTAACCCTGTATCATTTGCTAAAGCTGTTTCAATCAGACACCAATGCAATGCTG
GGGAAAAAGACAGTGGTTTCAGAGTTCTATGATGAAATGATATTTCAAGACCCAACAGCA
ATGATGCAACAATTATTGACAACATCTCGTCAGCTAACATTAGGAGCCTATAAGCATGAA
ACAGAATAATCAAGAATGATTGAGAATAGGAACGGCTCAAGACGTTCACAACTAAGGCCA
TGAATAGCTAGGAATTCCCTTTAAGAGCAAAGGTTTTATCATCAGACAGACCTACTTGCA
GGATATTACTCTATGAAGATGTAATGTTTGGAGCTGCAGCGATCATTTTGGAATCATGAG
GCAATCAACCTAAGAATGAAAGCCAACAAGTTGAAGAAAGCAGGACAGAATAAAGACCCT
GGATTCTTGGTGACACTTTTGGTTTCCAAAACTACTCTGAGATGGCCAGCTTTGAACTTA
CCAAGTCAATAATGAAAGCTTGTATGGTTTAAATCATGATTAGTTGGCTTTTTTGTTAAT
TGCCACAATGCCTTATATGTGGCCATCACAGTAGAAAATTGAGGGAGCGAAAGATCCTAA
CCTGCTACAGGGGTCACTCAGAGATAGCCTCATTTCCATACTCAGGAGACAGGATGCATA
CTCTTGGTTAATCTTCTGTGTGTCTCATTAGTCTTTATCCTTCCCTTCCATAGTCTCAGC
TGAATCAGATGAAGCTACTTTATTCATCTACATTTTCTTCTTTGTTGCTTTCCTTGTTCT
CTCCCAGACGGAATTCATTTTTCTCATTTAAAGTCTGATATGGTTTGCCTTTGCATCCCC
ACCCAAATTCCATCTTGAATTGTAATCGTCAGGGGTTGAGGGAGAGACCTGGTGGGAGGT
GACTGGCTCATGGGGGCAGATTTCTCCCATGCTGTTCTCGTGATAGTGAGTGAGTTCTCA
CGAGATCTGATGGCTTTATAAGGAGCTCTTTCCCCTTCGCTCTCCCTCACTTCCCTCCCG
CCACCTTGTGAAGGAGGTGCCTGCTTCCCCTTCACCTTCTGCCATGATTGTCAGTTTTCT
GAGGCCTCCCAAAGCCATGCAGAACTCTGAGTTAATTAAACCTCTTTCCTTTATAAATTA

Protein Sequence

>8089 : length: 227
MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMS
AYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKL
FQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTR
EKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI