ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

80789

Name

INTS5

Synonym

INT5|KIAA1698;integrator complex subunit 5;INTS5;integrator complex subunit 5

Definition

-

Position

11q12.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

80789

Links to epithelial mesenchymal transition gene database

80789

Links to ovarian cancer gene database

80789

Links to endometrial cancer gene database

80789

Links to iHOP

80789

Sequence Information

Nucleotide Sequence

>80789 : length: 3300
ATGCGCCGCCTGCGCTCCGCCGCTCGCGCCTCGGGCTCGGCTCGGGCTCCGGGATGTCCG
CGCTGTGCGACCCTCCCGGGGCCCCAGGGCCACCTGGGCCTGCCCCGGCCACCCACGGTC
CCGCGCCTCTCAGTGCTCAGGAGCTGTCCCAGGAAATCAAGGCTTTTCTGACTGGCGTAG
ACCCCATTCTGGGCCACCAACTCTCAGCCCGGGAACATGCTCGCTGTGGTCTTCTCCTGC
TCCGTTCTTTGCCACCTGCTCGGGCTGCTGTGCTTGACCACTTGAGAGGTGTCTTTGATG
AGAGTGTCCGGGCCCACCTGGCTGCCCTGGATGAAACCCCTGTGGCTGGTCCACCTCACC
TCCGTCCACCTCCACCCTCTCATGTCCCTGCTGGTGGACCTGGTCTAGAGGATGTGGTTC
AGGAAGTGCAGCAGGTGCTGTCTGAGTTTATCCGGGCCAACCCAAAGGCCTGGGCACCTG
TGATTAGTGCATGGTCCATTGACCTCATGGGGCAACTGAGCAGCACGTACTCAGGCCAGC
ACCAGCGTGTTCCCCACGCTACTGGCGCTCTTAATGAACTGCTACAGCTGTGGATGGGTT
GTAGGGCCACGCGTACATTAATGGACATCTATGTGCAGTGCCTCTCGGCTCTCATTGGTA
GCTGCCCAGATGCGTGTGTGGATGCCTTGCTGGATACCTCTGTTCAGCATTCTCCACACT
TTGACTGGGTTGTGGCACATATTGGCTCCTCTTTTCCTGGCACCATCATTTCCCGGGTTC
TCTCCTGTGGCCTTAAGGACTTTTGTGTCCATGGTGGGGCTGGAGGTGGAGCTGGCAGTA
GTGGTGGAAGCTCTTCTCAGACCCCCTCTACAGACCCCTTCCCTGGATCTCCTGCCATTC
CTGCGGAGAAACGGGTGCCCAAGATTGCCTCAGTTGTAGGCATCCTAGGTCACCTGGCCT
CCCGCCACGGAGATAGCATCCGACGGGAGCTCCTGCGAATGTTCCATGATAGCCTGGCAG
GGGGATCTGGAGGCCGCAGTGGGGACCCCTCCCTTCAGGCCACGGTTCCGTTCCTACTGC
AGCTGGCAGTCATGTCACCAGCTTTGCTGGGCACTGTCTCTGGAGAGCTTGTGGATTGCC
TCAAGCCCCCAGCTGTGCTGAGCCAGCTGCAGCAACACCTTCAAGGATTCCCCCGAGAGG
AGCTGGACAACATGTTGAACCTGGCTGTGCACCTGGTGAGCCAGGCCTCTGGGGCAGGTG
CCTACCGCTTGCTGCAGTTCCTGGTGGACACAGCTATGCCTGCTTCGGTCATTACCACCC
AGGGCCTGGCTGTGCCAGACACCGTGCGTGAGGCTTGTGACCGGCTAATCCAGCTGCTGC
TGCTGCACCTGCAAAAACTGGTTCATCACCGGGGAGGGTCTCCTGGGGAAGGGGTGCTAG
GCCCGCCCCCACCTCCCCGCTTGGTGCCCTTTTTAGATGCGCTCAAAAACCATGTTGGAG
AGCTGTGTGGAGAGACGTTACGATTGGAACGGAAGCGCTTCCTCTGGCAGCACCAGCTCT
TGGGCCTGCTGTCTGTCTATACCCGGCCTAGCTGTGGACCTGAGGCCTTGGGCCATCTGC
TGAGCCGAGCCCGAAGCCCTGAAGAGTTGAGTTTGGCCACCCAGTTATATGCAGGGCTAG
TGGTCAGCCTCTCTGGCCTCCTGCCCCTGGCTTTCCGAAGCTGTCTGGCTCGGGTGCATG
CAGGGACATTACAGCCTCCCTTCACGGCCCGGTTCCTGCGCAACTTGGCACTGCTAGTAG
GGTGGGAACAGCAGGGTGGCGAGGGCCCTGCAGCCCTAGGGGCGCACTTTGGGGAATCTG
CCTCAGCCCATCTGTCTGACCTGGCTCCTCTCCTGCTACATCCTGAGGAGGAAGTAGCTG
AAGCTGCTGCCTCTCTCCTGGCCATTTGTCCCTTTCCTTCTGAAGCCTTATCCCCCTCCC
AGCTCCTGGGACTGGTAAGGGCTGGGGTGCACCGCTTCTTTGCCTCTCTGAGGCTGCATG
GACCCCCAGGTGTGGCCTCAGCCTGTCAGCTTCTCACCCGCCTGTCTCAGACATCCCCAG
CTGGGCTCAAGGCTGTCCTGCAGCTGCTGGTTGAAGGAGCCTTACATCGAGGCAACACAG
AACTGTTTGGTGGGCAAGTAGATGGGGACAATGAGACTCTCTCAGTTGTTTCAGCTTCTT
TGGCTTCTGCCTCCCTGTTGGACACTAACCGGAGGCACACTGCAGCTGTGCCAGGTCCTG
GAGGGATTTGGTCAGTTTTCCATGCTGGAGTCATCGGCCGTGGCTTAAAGCCACCCAAGT
TTGTCCAGTCACGAAATCAGCAGGAAGTGATCTATAACACCCAGAGCCTCCTCAGCCTCC
TGGTTCACTGCTGCAGTGCCCCAGGGGGCACTGAATGTGGGGAATGCTGGGGGGCACCCA
TCTTGAGTCCAGAGGCAGCCAAAGCAGTGGCAGTGACCTTGGTGGAGAGTGTGTGTCCCG
ATGCAGCTGGTGCAGAGCTGGCCTGGCCCCCCGAGGAACACGCCCGGGCCACCGTGGAGC
GGGATCTCCGCATTGGCCGGCGCTTCCGCGAACAGCCCCTGCTCTTTGAGCTGTTAAAGC
TGGTAGCAGCTGCACCCCCAGCCCTGTGCTACTGTTCCGTGCTGCTTCGGGGGCTGCTGG
CCGCCCTCTTGGGCCATTGGGAAGCCTCTCGCCACCCTGACACGACCCACTCCCCCTGGC
ACCTGGAGGCATCCTGCACCTTAGTGGCTGTCATGGCTGAGGGAAGCCTCCTGCCTCCGG
CCCTGGGTAATATGCATGAAGTATTTAGCCAACTGGCACCTTTCGAGGTGCGTCTGCTGC
TGCTCAGTGTCTGGGGTTTTCTCCGGGAGCATGGGCCCTTGCCTCAGAAGTTCATCTTCC
AATCAGAGCGGGGTCGCTTCATTCGGGACTTCTCCAGGGAGGGTGGAGGTGAGGGTGGAC
CCCATCTGGCTGTGCTGCACAGTGTCCTCCACCGCAACATCGACCGCCTAGGTCTTTTCT
CTGGCCGTTTCCAGGCACCTTCACCGTCCACTCTCCTTCGACAGGGGACGTAGCCTTTTC
TTGCTCTGGAAGCCCAGGGAGGTTGAGCAGTGAGAGAGGGAAGGGACTAACGTGCTCCGG
AAGGGTGGAGGTTTCTCTTCTAAGTCCTTGGTCTAAAGAGCGCTGTCACTTTTTTCTCTC
CCACTTTTTTTTTTCTAAATAAAATTTGCCAACTTGAGAAAACCAAAAAAAAAAAAAAAA

Protein Sequence

>80789 : length: 1019
MSALCDPPGAPGPPGPAPATHGPAPLSAQELSQEIKAFLTGVDPILGHQLSAREHARCGL
LLLRSLPPARAAVLDHLRGVFDESVRAHLAALDETPVAGPPHLRPPPPSHVPAGGPGLED
VVQEVQQVLSEFIRANPKAWAPVISAWSIDLMGQLSSTYSGQHQRVPHATGALNELLQLW
MGCRATRTLMDIYVQCLSALIGSCPDACVDALLDTSVQHSPHFDWVVAHIGSSFPGTIIS
RVLSCGLKDFCVHGGAGGGAGSSGGSSSQTPSTDPFPGSPAIPAEKRVPKIASVVGILGH
LASRHGDSIRRELLRMFHDSLAGGSGGRSGDPSLQATVPFLLQLAVMSPALLGTVSGELV
DCLKPPAVLSQLQQHLQGFPREELDNMLNLAVHLVSQASGAGAYRLLQFLVDTAMPASVI
TTQGLAVPDTVREACDRLIQLLLLHLQKLVHHRGGSPGEGVLGPPPPPRLVPFLDALKNH
VGELCGETLRLERKRFLWQHQLLGLLSVYTRPSCGPEALGHLLSRARSPEELSLATQLYA
GLVVSLSGLLPLAFRSCLARVHAGTLQPPFTARFLRNLALLVGWEQQGGEGPAALGAHFG
ESASAHLSDLAPLLLHPEEEVAEAAASLLAICPFPSEALSPSQLLGLVRAGVHRFFASLR
LHGPPGVASACQLLTRLSQTSPAGLKAVLQLLVEGALHRGNTELFGGQVDGDNETLSVVS
ASLASASLLDTNRRHTAAVPGPGGIWSVFHAGVIGRGLKPPKFVQSRNQQEVIYNTQSLL
SLLVHCCSAPGGTECGECWGAPILSPEAAKAVAVTLVESVCPDAAGAELAWPPEEHARAT
VERDLRIGRRFREQPLLFELLKLVAAAPPALCYCSVLLRGLLAALLGHWEASRHPDTTHS
PWHLEASCTLVAVMAEGSLLPPALGNMHEVFSQLAPFEVRLLLLSVWGFLREHGPLPQKF
IFQSERGRFIRDFSREGGGEGGPHLAVLHSVLHRNIDRLGLFSGRFQAPSPSTLLRQGT