ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8061

Name

FOSL1

Synonym

FRA|FRA1|fra-1;FOS-like antigen 1;FOSL1;FOS-like antigen 1

Definition

FOS-like antigen-1|fos-related antigen 1

Position

11q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Calcium signaling in the CD4+ TCR pathway;PID Curated;200159

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

Downstream signaling in naive CD8+ T cells;PID Curated;200184

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

bone remodeling;PID BioCarta;100052

External Links

Links to cell senescence gene database

8061

Links to epithelial mesenchymal transition gene database

8061

Links to ovarian cancer gene database

8061

Links to endometrial cancer gene database

8061

Links to iHOP

8061

Sequence Information

Nucleotide Sequence

>8061 : length: 1759
ACGGGCCAAGGCGGCGCGTCTCGGGGGTGGAGCCTGGAGGTGACCGCGCCGCTGCAACGC
CCCCACCCCCCGCGGTCGCAGTGGTTCAGCCCGAGAACTTTTCATTCATAAAAAGAAAAG
ACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGC
CCCGGGCATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTA
CGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGAAGTTCCACCTGGT
GCCAAGCATCAACACCATGAGTGGCAGTCAGGAGCTGCAGTGGATGGTACAGCCTCATTT
CCTGGGGCCCAGCAGTTACCCCAGGCCTCTGACCTACCCTCAGTACAGCCCCCCACAACC
CCGGCCAGGAGTCATCCGGGCCCTGGGGCCGCCTCCAGGGGTACGTCGAAGGCCTTGTGA
ACAGATCAGCCCGGAGGAAGAGGAGCGCCGCCGAGTAAGGCGCGAGCGGAACAAGCTGGC
TGCGGCCAAGTGCAGGAACCGGAGGAAGGAACTGACCGACTTCCTGCAGGCGGAGACTGA
CAAACTGGAAGATGAGAAATCTGGGCTGCAGCGAGAGATTGAGGAGCTGCAGAAGCAGAA
GGAGCGCCTAGAGCTGGTGCTGGAAGCCCACCGACCCATCTGCAAAATCCCGGAAGGAGC
CAAGGAGGGGGACACAGGCAGTACCAGTGGCACCAGCAGCCCACCAGCCCCCTGCCGCCC
TGTACCTTGTATCTCCCTTTCCCCAGGGCCTGTGCTTGAACCTGAGGCACTGCACACCCC
CACACTCATGACCACACCCTCCCTAACTCCTTTCACCCCCAGCCTGGTCTTCACCTACCC
CAGCACTCCTGAGCCTTGTGCCTCAGCTCATCGCAAGAGTAGCAGCAGCAGCGGAGACCC
ATCCTCTGACCCCCTTGGCTCTCCAACCCTCCTCGCTTTGTGAGGCGCCTGAGCCCTACT
CCCTGCAGATGCCACCCTAGCCAATGTCTCCTCCCCTTCCCCCACCGGTCCAGCTGGCCT
GGACAGTATCCCACATCCAACTCCAGCAACTTCTTCTCCATCCCTCTAATGAGACTGACC
ATATTGTGCTTCACAGTAGAGCCAGCTTGGGGCCACCAAAGCTGCCCACTGTTTCTCTTG
AGCTGGCCTCTCTAGCACAATTTGCACTAAATCAGAGACAAAATATTTCCCATTTGTGCC
AGAGGAATCCTGGCAGCCCAGAGACTTTGTAGATCCTTAGAGGTCCTCTGGAGCCCTAAC
CCCTTCCAGATCACTGCCACACTCTCCATCACCCTCTTCCTGTGATCCACCCAACCCTAT
CTCCTGACAGAAGGTGCCACTTTACCCACCTAGAACACTAACTCACCAGCCCCACTGCCA
GCAGCAGCAGGTGATTGGACCAGGCCATTCTGCCGCCCCCTCCTGAACCGCACAGCTCAG
GAGGCGCCCTTGGCTTCTGTGATGAGCTGATCTGCGGATCTCAGCTTTGAGAAGCCTTCA
GCTCCAGGGAATCCAAGCCTCCACAGCGAGGGCAGCTGCTATTTATTTTCCTAAAGAGAG
TATTTTTATACAAACCTACCAAAATGGAATAAAAGGCTTGAAGCTGTGGCCTGAGTGCCT
CACTGGACCCAGAGGCCAATGGGAGAGTATTTGGAGCCCTAGGTCCCAGCCTTAGCTCTA
CAGACTCACTGCAAAAAAA

Protein Sequence

>8061 : length: 271
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLG
PSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAA
KCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKE
GDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPST
PEPCASAHRKSSSSSGDPSSDPLGSPTLLAL