ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

80326

Name

WNT10A

Synonym

OODD|SSPS|STHAG4;wingless-type MMTV integration site family, member 10A;WNT10A;wingless-type MMTV integration site family, member 10A

Definition

protein Wnt-10a

Position

2q35

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Disease

Ectodermal dysplasia;FunDO

Disease

Hair morphology;NHGRI

Disease

hair morphology;GAD

Disease

Odontoonychodermal dysplasia;OMIM

Disease

Common traits (Other);NHGRI

Disease

DEVELOPMENTAL;GAD

Disease

Schopf-Schulz-Passarge syndrome;OMIM

External Links

Links to cell senescence gene database

80326

Links to epithelial mesenchymal transition gene database

80326

Links to ovarian cancer gene database

80326

Links to endometrial cancer gene database

80326

Links to iHOP

80326

Sequence Information

Nucleotide Sequence

>80326 : length: 2375
ACAGTCACTTACTCTACAGGCAGTGGGGCCCGACACAGACAGCGCCGCCCCCGCCAGCCA
GCCTCGCACGCCCTCGGAAGCGCAGGCTCCCGGCGCTGCGCTGGAGGGTTCCCCGGCACC
CCAGCCTCCCGTCCCCAGCCCGCTGCACCTCCGGGCCCCCCTTACCCTTGAGAGGCACCG
GGAGTTGTCGCGGGGGGGCCTCGGGAAATTCCCCGGACCCCTGTGCCAGGAGGTGCCCGG
TTCGCCCGCTCTTCACCCCCCGCCCCCCCCGAGGGCGGTGCCCGGGGGTGCTGCCCCATG
GAGCGGGGAGGCGGGCGCCGTCTGCTCCGGGAGCCCTGACCCGAGTCGGAGCTGTGTGTC
GCAGCCGCCCCGACCCCCCGCCGATCATGCGCCGGCGCCCCTGGCTCTCCAGTCCCACTG
GGCTGTGAGCCCCCCACTCCCAGCCCGTCAGGGCCTGCGCGCCATGGGCAGCGCCCACCC
TCGCCCCTGGCTGCGGCTCCGACCCCAGCCCCAGCCGCGGCCAGCGCTCTGGGTGCTCCT
GTTCTTCCTACTGCTGCTGGCTGCTGCCATGCCCAGGTCAGCACCCAATGACATTCTGGA
CCTCCGCCTCCCCCCGGAGCCCGTGCTCAATGCCAACACAGTGTGCCTAACATTGCCAGG
CCTGAGCCGGCGGCAGATGGAGGTGTGTGTGCGTCACCCTGATGTGGCTGCCTCAGCCAT
ACAGGGCATCCAGATCGCCATCCACGAATGCCAACACCAATTCAGGGACCAGCGCTGGAA
CTGCTCAAGCCTGGAGACTCGCAACAAGATCCCCTATGAGAGTCCCATCTTCAGCAGAGG
TTTCCGAGAGAGCGCTTTTGCCTACGCCATCGCAGCAGCTGGCGTGGTGCACGCCGTGTC
CAATGCGTGTGCCCTGGGCAAACTGAAGGCCTGTGGCTGTGATGCGTCCCGGCGAGGGGA
CGAGGAGGCCTTCCGTAGGAAGCTGCACCGCTTACAACTGGATGCACTGCAGCGTGGTAA
GGGCCTGAGCCATGGGGTCCCGGAACACCCAGCCCTGCCCACAGCCAGCCCAGGCCTGCA
GGACTCCTGGGAGTGGGGCGGCTGCAGCCCCGACATGGGCTTCGGGGAGCGCTTTTCTAA
GGACTTTCTGGACTCCCGGGAGCCTCACAGAGACATCCACGCGAGAATGAGGCTTCACAA
CAACCGAGTTGGGAGGCAGGCAGTGATGGAGAACATGCGGCGGAAGTGCAAGTGCCACGG
CACGTCAGGCAGCTGCCAGCTCAAGACGTGCTGGCAGGTGACGCCCGAGTTCCGCACCGT
GGGGGCGCTGCTGCGCAGCCGCTTCCACCGCGCCACGCTCATCCGGCCGCACAACCGCAA
CGGCGGCCAGCTGGAGCCGGGCCCAGCGGGGGCACCCTCGCCGGCTCCGGGCGCTCCCGG
GCCGCGCCGACGGGCCAGCCCCGCCGACCTGGTCTACTTCGAAAAGTCTCCCGACTTCTG
CGAGCGCGAGCCGCGCCTGGACTCGGCGGGCACCGTGGGCCGCCTGTGCAACAAGAGCAG
CGCCGGCTCGGATGGCTGCGGCAGCATGTGCTGCGGCCGCGGCCACAACATCCTGCGCCA
GACGCGCAGCGAGCGCTGCCACTGCCGCTTCCACTGGTGCTGTTTCGTGGTCTGCGAAGA
GTGCCGCATCACCGAGTGGGTCAGCGTCTGCAAGTGAGCGGCCCGGGGTCCCCTGGGCCC
TGATCGAGGTCCCCTCCTGGAGCCTGGCCCTCTGAGGCTTACGGTCTTGGCAAGGCAGCA
TCGCCTTGGCTCTTGGGAAGAGGAGATTGGACCACATGATCTTATAGGAACCCCTCAGCT
CTGAGGTCTGTGATCGCCGGACAGTCCAGGCCTGTCTGAACCCCACCACTCACTTCTGTG
GGCTCTAGGACTGACTGGGTTCTTCCTCCCTCCCCGAAGCCCAGACAGTTCAGTTGGGCT
GGGGGTTGCTCCACACCCTAAAACAAGCCTCAGCCAGGCAACCCGTCAGTCTGTCTCCAT
CCTTTCACCCCTTCCCTGGAGATGGGAGGTGGGGAATGAATGGAAGCTGACGGGCAGAGA
GAGGAGGATTAAAAAAAAGAAATAGACATAACTGAGCTGAAGTAATTCCATAAAGGGCCC
AGACAGCCTCCTCCACCATTCCCTTCATCATTCATTTAACAAATATTTATTTTGCACTCT
CTTTGCGGCACTCTGGGGGCGGTGGGGTGCGTGGGGGTGGCAATGCAAGGCACTGAGGCC
ACAGATGTGAGTAAGCGAGACACAACACTTGTCCTCTTGGAGGTTACATTCTTGCTGGGG
GGAGGCATGGGCAATAAACAAGTAAATATACAAAC

Protein Sequence

>80326 : length: 417
MGSAHPRPWLRLRPQPQPRPALWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK