ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8031

Name

NCOA4

Synonym

ARA70|ELE1|PTC3|RFG;nuclear receptor coactivator 4;NCOA4;nuclear receptor coactivator 4

Definition

70 kDa AR-activator|70 kDa androgen receptor coactivator|NCoA-4|RET-activating gene ELE1|androgen receptor-associated protein of 70 kDa|ret fused

Position

10q11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

Cancers;KEGG DISEASE

Disease

Thyroid carcinoma, papillary;OMIM

Disease

Cancers of endocrine organs;KEGG DISEASE

External Links

Links to cell senescence gene database

8031

Links to epithelial mesenchymal transition gene database

8031

Links to ovarian cancer gene database

8031

Links to endometrial cancer gene database

8031

Links to iHOP

8031

Sequence Information

Nucleotide Sequence

>8031 : length: 3748
AGAGGGCAGTCAAGGGCTTCTGGCTGACCCGAGCGGAGATCTCGCGAGACTGTCAGACGT
ATGGCGAGAGGTGTGGGAGGAAGATTGTGTTGTCGCGAGAACTCTGCCTTTGGGCCGTAG
GTTAGTGTGGGGCCGTGTCTCAGTCCACCCAAGGTCTCCTCGGATCGCCTGGAGAGGCAC
TCGGACCTGTTATGTCTGGACACATTGCTTCAACATAGAACGCACATGAACAATGTGGAG
GTCTAGGCTGGAATGGGGGCCCAGTTGACCACTTTTGCTCTAGCTGGAGCAGTGAGGAGA
ATGAATACCTTCCAAGACCAGAGTGGCAGCTCCAGTAATAGAGAACCCCTTTTGAGGTGT
AGTGATGCACGGAGGGACTTGGAGCTTGCTATTGGTGGAGTTCTCCGGGCTGAACAGCAA
ATTAAAGATAACTTGCGAGAGGTCAAAGCTCAGATTCACAGTTGCATAAGCCGTCACCTG
GAATGTCTTAGAAGCCGTGAGGTATGGCTGTATGAACAGGTGGACCTTATTTATCAGCTT
AAAGAGGAGACACTTCAACAGCAGGCTCAGCAGCTCTACTCGTTATTGGGCCAGTTCAAT
TGTCTTACTCATCAACTGGAGTGTACCCAAAACAAAGATCTAGCCAATCAAGTCTCTGTG
TGCCTGGAGAGACTGGGCAGTTTGACCCTTAAGCCTGAAGATTCAACTGTCCTGCTCTTT
GAAGCTGACACAATTACTCTGCGCCAGACCATCACCACATTTGGGTCTCTCAAAACCATT
CAAATTCCTGAGCACTTGATGGCTCATGCTAGTTCAGCAAATATTGGGCCCTTCCTGGAG
AAGAGAGGCTGTATCTCCATGCCAGAGCAGAAGTCAGCATCCGGTATTGTAGCTGTCCCT
TTCAGCGAATGGCTCCTTGGAAGCAAACCTGCCAGTGGTTATCAAGCTCCTTACATACCC
AGCACCGACCCCCAGGACTGGCTTACCCAAAAGCAGACCTTGGAGAACAGTCAGACTTCT
TCCAGAGCCTGCAATTTCTTCAATAATGTCGGGGGAAACCTAAAGGGCTTAGAAAACTGG
CTCCTCAAGAGTGAAAAATCAAGTTATCAAAAGTGTAACAGCCATTCCACTACTAGTTCT
TTCTCCATTGAAATGGAAAAGGTTGGAGATCAAGAGCTTCCTGATCAAGATGAGATGGAC
CTATCAGATTGGCTAGTGACTCCCCAGGAATCCCATAAGCTGCGGAAGCCTGAGAATGGC
AGTCGTGAAACCAGTGAGAAGTTTAAGCTCTTATTCCAGTCCTATAATGTGAATGATTGG
CTTGTCAAGACTGACTCCTGTACCAACTGTCAGGGAAACCAGCCCAAAGGTGTGGAGATT
GAAAACCTGGGCAATCTGAAGTGCCTGAATGACCACTTGGAGGCCAAGAAACCATTGTCC
ACCCCCAGCATGGTTACAGAGGATTGGCTTGTCCAGAACCATCAGGACCCATGTAAGGTA
GAGGAGGTGTGCAGAGCCAATGAGCCCTGCACAAGCTTTGCAGAGTGTGTGTGTGATGAG
AATTGTGAGAAGGAGGCTCTGTATAAGTGGCTTCTGAAGAAAGAAGGAAAGGATAAAAAT
GGGATGCCTGTGGAACCCAAACCTGAGCCTGAGAAGCATAAAGATTCCCTGAATATGTGG
CTCTGTCCTAGAAAAGAAGTAATAGAACAAACTAAAGCACCAAAGGCAATGACTCCTTCT
AGAATTGCTGATTCCTTCCAAGTCATAAAGAACAGCCCCTTGTCGGAGTGGCTTATCAGG
CCCCCATACAAAGAAGGAAGTCCCAAGGAAGTGCCTGGTACTGAAGACAGAGCTGGCAAA
CAGAAGTTTAAAAGCCCCATGAATACTTCCTGGTGTTCCTTTAACACAGCTGACTGGGTC
CTGCCAGGAAAGAAGATGGGCAACCTCAGCCAGTTATCTTCTGGAGAAGACAAGTGGCTG
CTTCGAAAGAAGGCCCAGGAAGTATTACTTAATTCACCTCTACAGGAGGAACATAACTTC
CCCCCAGACCATTATGGCCTCCCTGCAGTTTGTGATCTCTTTGCCTGTATGCAGCTTAAA
GTTGATAAAGAGAAGTGGTTATATCGAACTCCTCTACAGGCATACTTCAAAATGAACTTT
CAAGATGTAACCGTTGGGAATTTTCAGATCCCATGTGGATTCTAGTAGTTTATATACCTA
CCTCGAAGATGTGAAGGAATGGACAAGAGTTGAGCAGCCTTTCTGCTGATTATCACACAT
CATGAGCTGAGTGACTGCAGCTTGCCAAATCTTTGTGTTTCTGGGTCTGACCAATTAGCT
TAGTTCTTCTCCTGCCTAATTTTGAACTAGTAAAGCAAAGTGAGTCATCAGATTATGAGT
TACTGTTTAAAAGAAAAATGCTGTTTATTCATGCTGAGGTGATTCAGTTCCCTCCTTCTT
ACAGAAGTATTTTAATTCACCCCACACTAGAAATGCAGCATCTTTGTGGACGTCTTTTTC
ACAAGCCTCCAAGGCTCCTTAGATTGGGTCGTTACTAAAAGTACATTAAAACACTCTTGT
TTATCGAAGTATATTGATGTATTCTAAAGCTAGTAAACTTCCCTAACGTTTAATTGCCCT
ACAGATGCTTCTCTTGCTGTGGGTTTTCTTTTGTTAGTGGTCTGAAATAATTATTTTCCT
GTTCTATTAATACATAGTGTATTTTGCACAAAAAAATTAACCTGGTCAATAGTGATTACC
AAAATATATATTAATAATCTTGGCAATTTTTGACATTAATTATGAAACATTTTAGCCCAC
GTTAGTTCTACATTATTCTTCACTTAAACTCAGCTACTGCAAATTTTGTCTTTCTGTAAA
TGTTATTAAAATATCCAGTGAGCTCTTTAGAAGGACTCAGTATTATTTCAAGACTATTTT
TGAGGTAATTCTAGCCTTTTAAAATATTCTACAGACCTACGGGGCTTAAAAGAACCCCAG
TACCGACTAAGCAAATAGGCAAAAGACATGTTGGAAATGTAGTATAGTACTTGAAACAGT
CACTATCATAGGGATAATTGGTGCATCCTGTGTAAATGGAAGCTGAGCTTGACACCTGGT
GCTTTTAAGTAGGGATAAAGTCATCCTCTCACTGCAAGCACAGCATACCTGTACCTCCAA
AAGTGACGTTTTAGTGAACAGGCCGTTTTCAACACTTGTGCCTTGGGGTGTTCATTGAAG
CTTTGTGAAAACTACTGATGTTTTCTCAGTCTCCTTAAAGTTACGTCCATGCTTTAAAAT
GTCTGTGTAGGAGAGAAGTGGGGTTTATAATGTTTTCTCTAAGATATCTTTGCTGCTTTC
CAGACTTTGAAACTATTAAGCTTCTTAACTGCCTCTTACCGGAAATACTTCTGGGGAAAC
TTCATGGTCCCAAAATGTCATTGCCATACAGCTTCACTAGAGTTCTTTGAACCACAGCTG
AAAAGAGCTTTGTATTATTTTTTAATTCCCTCCCCAGATATCATTTAGGAGTATTATATA
AAGGTGGTGGGCAAAAACAATGTAAGGAGCCTTTCCAGTTATCTTGAGTTGCAGCTCTGT
AGTTTCTTGAGGCCAAACACACTGTATTTTACAAGTCAAAATATAATTTACATTAATCAC
TATGTTAATGAGTATGTAAAACATTCTTTTGCATTGATGAATTTTGTATCTGCTTCCATT
AAAAGCATAACAGCCATAAAAAAAAAAA

Protein Sequence

>8031 : length: 650
MGAQLTTFALAGAVRRMNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDN
LREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTH
QLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPE
HLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDP
QDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIE
MEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKT
DSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVC
RANEPCTSFAECVCDENCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPR
KEVIEQTKAPKAMTPSRIADSFQVIKNSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFK
SPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDH
YGLPAVCDLFACMQLKVDKEKWLYRTPLQAYFKMNFQDVTVGNFQIPCGF