ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8030

Name

CCDC6

Synonym

D10S170|H4|PTC|TPC|TST1;coiled-coil domain containing 6;CCDC6;coiled-coil domain containing 6

Definition

coiled-coil domain-containing protein 6|papillary thyroid carcinoma-encoded protein

Position

10q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Disease

Thyroid papillary carcinoma;OMIM

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

Cancers;KEGG DISEASE

Disease

Cancers of endocrine organs;KEGG DISEASE

External Links

Links to cell senescence gene database

8030

Links to epithelial mesenchymal transition gene database

8030

Links to ovarian cancer gene database

8030

Links to endometrial cancer gene database

8030

Links to iHOP

8030

Sequence Information

Nucleotide Sequence

>8030 : length: 5842
AGTGCAATACTGCCCAAGCCCGGGCGGGGTCTCTGTTCTCTGGCAGAGGAGGTCCCTTGG
CAGCGGGAAGCGCCCTCTCTTTCTCTCGCCGCCGCTCCGAGTCTGCGCCCTGGTGCCAGG
CGCTCAGCTCGGCGCTCCCCTGTGCTCGCCCGGCGCCCACTCATTCGCAGCCCGGCCTTC
GTCGCCGCCGCCTCCCTGCTGCTCCTCCTCCTTTCCCCAGCCCGCCGCGGCCATGGCGGA
CAGCGCCAGCGAGAGCGACACGGACGGGGCGGGGGGCAACAGCAGCAGCTCGGCCGCCAT
GCAGTCGTCCTGCTCGTCGACCTCGGGCGGCGGCGGTGGCGGCGGGGGAGGCGGCGGCGG
TGGGAAGTCGGGGGGCATTGTCATCTCGCCGTTCCGCCTGGAGGAGCTCACCAACCGCCT
GGCCTCGCTGCAGCAAGAGAACAAGGTGCTGAAGATAGAGCTGGAGACCTACAAACTGAA
GTGCAAGGCACTGCAGGAGGAGAACCGCGACCTGCGCAAAGCCAGCGTGACCATCCAAGC
CAGGGCTGAGCAGGAAGAAGAATTCATTAGTAACACTTTATTCAAGAAAATTCAGGCTTT
GCAGAAGGAGAAAGAAACCCTTGCTGTAAATTATGAGAAAGAAGAAGAATTCCTCACTAA
TGAGCTCTCCAGAAAATTGATGCAGTTGCAGCATGAGAAAGCCGAACTAGAACAGCATCT
TGAACAAGAGCAGGAATTTCAGGTCAACAAACTGATGAAGAAAATTAAAAAACTGGAGAA
TGACACCATTTCTAAGCAACTTACATTAGAACAGTTGAGACGGGAGAAGATTGACCTTGA
AAATACATTGGAACAAGAACAAGAAGCACTAGTTAATCGCCTCTGGAAAAGGATGGATAA
GCTTGAAGCTGAAAAGCGAATCCTGCAGGAAAAATTAGACCAGCCCGTCTCTGCTCCACC
ATCGCCTAGAGATATCTCCATGGAGATTGATTCTCCAGAAAATATGATGCGTCACATCAG
GTTTTTAAAGAATGAAGTGGAACGGCTGAAGAAGCAACTGAGAGCTGCTCAGTTACAGCA
TTCAGAGAAAATGGCACAGTATCTGGAGGAGGAACGTCACATGAGAGAAGAGAACTTGAG
GCTCCAGAGGAAGCTGCAGAGGGAGATGGAGAGAAGAGAAGCCCTCTGTCGACAGCTCTC
CGAGAGTGAGTCCAGCTTAGAAATGGACGACGAAAGGTATTTTAATGAGATGTCTGCACA
AGGATTAAGACCTCGCACTGTGTCCAGCCCGATCCCTTACACACCTTCTCCGAGTTCAAG
CAGGCCTATATCACCTGGTCTATCATATGCAAGTCACACGGTTGGTTTCACGCCACCAAC
TTCACTGACTAGAGCTGGAATGTCTTATTACAATTCCCCGGGTCTTCACGTGCAGCACAT
GGGAACATCCCATGGTATCACAAGGCCTTCACCACGGAGAAGCAACAGTCCTGACAAATT
CAAACGGCCCACGCCGCCTCCATCTCCCAACACACAGACCCCAGTCCAGCCACCTCCGCC
TCCACCTCCGCCACCCATGCAGCCCACGGTCCCCTCAGCAGCCACCTCGCAGCCTACTCC
TTCGCAACATTCGGCGCACCCCTCCTCCCAGCCTTAATGCATGAGCTTAGTCTGAATTTC
AAGTTGGGACTCATCCAATGGAGCCGTCTACTCAACGCCAAAGGCTTCCTTCTCTGGCAT
ATTTGGATATGACTTATTTGCACTGAGGTTATCTAGGCTTCACTATCCATTGTGTTGTAA
ATGTTTGTCAGAAATGCAGCCAGTGTTGTGGGTCTACAACACTAACCAGACGACTTTTTC
CATCAGTGTTTTACTTGAATCTTCATGTACGTCCATTCCCTGGCTGGAACCTTCGCTGTT
TGGTATTTGGTATTTCAGCAGCAGTGTGCAATTTTTGCTTGGCCCAGAGCTTCATTCTCC
TGGCTTTTAGGTTTGTAAAAGAAAAAGGGATATCTTTTTTATATTTTTTTCCATGAATCT
GCAGAAAATTACTGAGCTGTTGTTACCCTCCTCTCATTATAATAGTGTTTACCAAACATA
CCAATAATTCAGCACTACAATTCAGACCTTTGAAAATCTGGCTTTCAGTGTAGAACAGAA
AGTTAGATGAATCAGTGCCCAAGACATATTTTCTGTTTAACAGAACTTTCTACAGATACA
TTTTTTACAGGTTATTTTCATTGTGTTATTGACATCCATGTCTCTCGTAAAACAGATGGC
CCAAAGTAATGAATCATGTGGCTGTACCTTCTCCACATAAATGGGATGGATAATTATCGT
ATATTAAGATGTGATTCTCTTTTTTATCCTTAATGTTAATCTACTTAACCTGGCCCCCTC
TAACATGAGTCGATAAATGTTGTCCTACTCACCGGTGGTTTCAATGGCTAATTAGAATGT
GTTATTTGATTTCTGCTGCAGAAGGCAGTGTGATTGTAACAAAAACAATGCGGCTTCCCC
CTTTCGTACTTCATTTGTGTTCTCTTAAAATAGAGTTTGAACAAATATTTTAAAGGTGCA
AAATACCATTAGAAAATACTATTTGAAATGGACATTATCGCATTATCTTGGCATAATGGC
CAGAAAATATTGTATTGCTTGGCAGAAAAGAAAATAAGGTCTAAAGGAAAGTAGCACATT
AGCATTGATGGCTGTTCATTTCACCCAGTATAAGCAAGTGCAGTGTACAAAGAAGTATAT
TCTGAATACATTATTTCCATTCATTTAGCACAAATAAATCATTTGGTTTCACTTTGCAGT
GGAACACTGAGTCACTCTTTTCTTAACACGTGCAACATCTTAATTTTTGTTTTTCAGCAG
TTGCTGTTTTGTACTTTGGTAGTAAAGTGATTTTTACCACCTGTGTTTGCATATTTATAT
ATGCTGTGGATGAAAATAACTTACTAGAGAATGTATATTTTATGACAAGAATGTGTATCT
GTTGGATATAATCAGAGAACTGAAAAGTAATTTATCAGTAATTTTTAAGAGTCCATGTTT
TGTGACAACCATCTCTAATAGCCAACTCTTTATTAAACACACTCCTAAAAATAAGGAACC
ATGACATTGTAGATATTTAATATTGTACAGTATAGAAACCTCCATTTTTGCCTTCGAATG
CATATTTAAGAGTTAACAGAATGAAAAAAAAAAGTCTTGTTGGATAATAGTGTTTGACTA
GCGTTTTAAGAACTTGAGAGTAAAAGCAACAATAAGATTTTTTCACCTCTTCCTGCTTCC
ACCCCCAAACTGAGAACATCACTCAATTGTTTGGAAGAAACTGTAGGTCTATATAAATTT
TATTTATAATGTATGTGTAATATACATAATCATAATACAGTTCTCAGATGCAGGGAAGAA
GTTTGGCATTTAATCATTGAGGCTTTAGGTTTTTGATGTGATCAGACTGGGCCATGTCAA
ACCCGGAATTTTCACCAACAGTTCACTCACCCTCCTGGTACATTGCCATTCCAAGGAATT
CTGAGAGTAGGCAAACAAATTTTGCCTTCATGGTACAGTTCTCAGTTTTTCTTATAGGAG
AAATATGGTATATGTTTATAAGAATCTTTTATGAGATTATAGATTTCAATGCTGTGGATA
GTGTCTTGCACCCAAACAAGAAAGTCCATAATGGAATGATCTTCCCTCAGCTTCCTATCG
ATTTAGTTACCTCTTGAAAGCACAAAAATTAAAACATTGCCATATGTTGAATTTTTAAAA
AGCACTTGGAGTGAGCGAACATTTCCTGATAAATGCCTTTTAGAGATAGGTTCTTGATAT
TCAGACATCTGCAGAAATGTTCTGGTTCCCAAAGTCATTTCACTTCGAAATAAAACACAG
CTCCTTCAAACAGCACTTTTTCCACATAAATCTAGTTGCCTCTCCCTGTGGACATTCAGA
ACTGATAGAACAAACACTACTCTTTTGAATTTGATGGTTCGTGTCCTTTAAAGTGTTTGA
GGACCTATGCAGAGCCTGTAACACTTGGGTAGTACCTGCTAGGACAATTTCTTGGCAATT
GTCTTACTACTAGGGATCAGTAAGATTTAGATTCTGAGCCCATAATGGCAACAGCCCCCT
CACCTATGGGAAGCTGACTTCCCTCAGTCGGGCACTTCTCATGGGGGCTGAACATGGTTC
CTGCCATTCTGTTACCCACTCTCCCAGGTGAGCCCTGGATTGGCTCCCAGAAGGCCTTTG
TAAAATCAGTAGCCGTCCTGCAGGCAGGTGGGAGCAACAGGGGCTTCAGTAGCTTCATTT
TCCTGTCTTGCAGACAGAGACCCTTGGCTACCACTGTGCTGCTAATAGGATAAGTACTCT
GTTGCCAGATTACCATGCCTTTTATACAAAACCAAATTAACTTACCTAATACCTGACACC
TCTTTGGGCTCTGAACTGCTTTCTCTCATCAAGCATGCTAGCACTCTAGACAGAATTCTA
GAAATTTGGCAGATAGTGGAAGCCTTTAATTGAACTTACTCCTTCGTTGACTGAAAGGAG
TTTTAAATTCTGAGCTCCTGAGATACTGACTAGCAACCATGGAATGAATGTGTGACCAGA
AAGTGGCTTTGACACCAAGTGCTACTGTCCCTTTGTAATTGGCTTCTAACAGAATTCAAC
CAGAAATAATTGATAATGTGAATTTTTGTTAATTGTTCACTTGTAGGAAAATAGAACATG
TATCACCCTTTGTTAGGTAGACATGAACTTTTCCTGCACAAAGCCTTGCTTTTAGAGAAT
GCCCAATAAGGCAAGAAAAAGCATAGTAACTTGTGCTTTGAGAGCTCAATATTTGTATCT
TATCAGTACAGAAGAAATATTTCTGTGTAACTTGATCTTCTGTCTAGTACTTGTCTTATA
GGTAACCAACACTGAAAACTTTGTAGTGATGACTACCAAAGAAATACATAGTAAAACAAC
CTTTTATTTCCAAATTGTTAAAGAGCCAGCCATTGATGCTGCTACATGAGTTCCATGCTC
AAGAGCCATTGTAAGAGATTAAGGGGTTTCTAGGTTTTTGGTGATTTTTTGTTTGTTTTT
TTCTTTGTTTTTTAGGGTTTTTTTTTCTTCTTTAATTTTTTGATTAAAACATACACACAG
CTGTTAGCATAAAGTCGTGGGGGGCATTTTCTGGAATGCTCAGCAGTTCTGATTAACTGC
CAAGCCCAGGTTGCCTCTCATGAGGCAACTGAAAAAATCCTGTGTCTTGATAGCATGGGT
GCTGTGTGTGTGCATGTGTGTGTCTGCATTCATGCCTTAACTCGGGTTACTGCACAACTT
TAGTTCTTGACTTAGTCTGCACCGTCATCTAGATTGTATTGTACATCTCGGTCTGAACTT
CATCCTGGCAAAAACAAAGTTGCAGGCACAACAGTTTAAGAATGCATTCCTCCAGAAGAG
TATCTGGTCAGGTTGACCCCTGAGCCTTCTTTGGACTTGATTTGGAACTTAGCCTGGAAA
GCGAAAGTGGACTGTCCAACAGAAAGATGTCAACAAGGAAAAGAGGAGAGCCAAGCGCTA
GCATGCCTTTTGCCTCTGCATATCTGTGCACACTGTATGTTGTTCATGATAGCTTGTCTA
CAACTTGACTAGGTTGGAGTTCTGGTAATAGTGGCAATCTTGACATTCTTGGTCAGAGTT
TAGAGAGATGTAAGACTTTCAATTAATGTCTTATTTACTCCTTTATGTTGATTAGTCTTT
GATACATGTGCTGAATCAGAAACCTAAATAAAGATAATTTTTTAAAATGTACCTCTTGAG
CCTTAAAAAAAAAAAAAAAAAA

Protein Sequence

>8030 : length: 474
MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELT
NRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKI
QALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKK
LENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVS
APPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREE
NLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSP
SSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSP
DKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP