ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

8021

Name

NUP214

Synonym

CAIN|CAN|D9S46E|N214|p250;nucleoporin 214kDa;NUP214;nucleoporin 214kDa

Definition

CAN protein, putative oncogene|nuclear pore complex protein Nup214

Position

9q34.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Sumoylation by RanBP2 regulates transcriptional repression;PID Curated;200097

Pathway

Signaling events mediated by HDAC Class II;PID Curated;200019

Pathway

BMP receptor signaling;PID Curated;200123

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Pathway

Transmembrane transport of small molecules;Reactome;REACT:15518

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Regulation of cytoplasmic and nuclear SMAD2/3 signaling;PID Curated;200152

Pathway

Metabolism of carbohydrates;Reactome;REACT:474

Disease

Leukemia, T-cell acute lymphoblastic;OMIM

Disease

Leukemia, acute myeloid;OMIM

External Links

Links to cell senescence gene database

8021

Links to epithelial mesenchymal transition gene database

8021

Links to ovarian cancer gene database

8021

Links to endometrial cancer gene database

8021

Links to iHOP

8021

Sequence Information

Nucleotide Sequence

>8021 : length: 8198
GGACGACTAAGATGTCTTCAAGATTACATGAGATCCCACATCTGAAGGTTTTTGCAAAGG
ACTTGGCACAAACTCGTGCGACTAGACATGGATATGGCTCTTGCTCTGGAAAGGATCACC
TTGATAGGAGCAAACAAAGCTGGTCTTCGGTGCCCTTTAATCTCCCCTCCCAGCCTTCCA
CCTTCCACACTTTAAGAGTCGTCCCTGCCGACCCCCCGACCCCGTTTTTCTGAACCTCCC
TTCCTCCCCTTGCATAGTCCAAAGCCTCTCTCTAAAGCAGCCCCCCGAAAACATCTGTCA
AGTTCCAAACTTATCTGAATCGGAAGCTACCAATAGCCAACCTACATCTAAGGGGAACTG
TAAGATTTCAGAAGAACAAGAAGCATAGGTCGCTTAGGCGTGGGCCACCCAAGAAGAGAG
ACTTAACACTAGGTAAGCCCGCGCTGGCTGCGAAGGCGGGAGCGGCACCAGGACCATCCA
GGGCGCAGGCGCAGGGACCTCACGGCCACGCCACTACTCAGCCCGAGCTGGCCAATGGGG
AGCGGCGGCCGGAAGAACGCGCGGCTTCGCTAGGTTCCGCGGCTTCCTCTGACCAAGCTT
GACGTCACCAAAGCGCGCCGGAAATGCGAGGTCAACTGCGCGCCGCTGGCGCTGAGGGGA
GGAAGTTTGCTGTCGAGCGGCCTGGGTTCCGTGGGCAAGGCCGTGGGAGGCAGCGTTGGC
TGCTTCGACACACTGAGGGCGGCGCGATGGGAGACGAGATGGATGCCATGATTCCCGAGC
GGGAGATGAAGGATTTTCAGTTTAGAGCGCTAAAGAAGGTGAGAATCTTTGACTCCCCTG
AGGAATTGCCCAAGGAACGCTCGAGTCTGCTTGCTGTGTCCAACAAATATGGTCTGGTCT
TCGCTGGTGGAGCCAGTGGCTTGCAGATTTTTCCTACTAAAAATCTTCTTATTCAAAATA
AACCCGGAGATGATCCCAACAAAATAGTTGATAAAGTCCAAGGCTTGCTAGTTCCTATGA
AATTCCCAATCCATCACCTGGCCTTGAGCTGTGATAACCTCACACTCTCTGCGTGCATGA
TGTCCAGTGAATATGGTTCCATTATTGCTTTTTTTGATGTTCGCACATTCTCAAATGAGG
CTAAACAGCAAAAACGCCCATTTGCCTATCATAAGCTTTTGAAAGATGCAGGAGGCATGG
TGATTGATATGAAGTGGAACCCCACTGTCCCCTCCATGGTGGCAGTTTGTCTGGCTGATG
GTAGTATTGCTGTCCTGCAAGTCACGGAAACAGTGAAAGTATGTGCAACTCTTCCTTCCA
CGGTAGCAGTAACCTCTGTGTGCTGGAGCCCCAAAGGAAAGCAGCTGGCAGTGGGAAAAC
AGAATGGAACTGTGGTCCAGTATCTTCCTACTTTGCAGGAAAAAAAAGTCATTCCTTGTC
CTCCGTTTTATGAGTCAGATCATCCTGTCAGAGTTCTGGATGTGCTGTGGATTGGTACCT
ACGTCTTCGCCATAGTGTATGCTGCTGCAGATGGGACCCTGGAAACGTCTCCAGATGTGG
TGATGGCTCTACTACCGAAAAAAGAAGAAAAGCACCCAGAGATATTTGTGAACTTTATGG
AGCCCTGTTATGGCAGCTGCACGGAGAGACAGCATCATTACTACCTCAGTTACATTGAGG
AATGGGATTTAGTGCTGGCAGCATCTGCGGCTTCAACAGAAGTTAGTATCCTTGCTCGAC
AAAGTGATCAGATTAATTGGGAATCTTGGCTACTGGAGGATTCTAGTCGAGCTGAATTGC
CTGTGACAGACAAGAGTGATGACTCCTTGCCCATGGGAGTTGTCGTAGACTATACAAACC
AAGTGGAAATCACCATCAGTGATGAAAAGACTCTTCCTCCTGCTCCAGTTCTCATGTTAC
TTTCAACAGATGGTGTGCTTTGTCCATTTTATATGATTAATCAAAATCCTGGGGTTAAGT
CTCTCATCAAAACACCAGAGCGACTTTCATTAGAAGGAGAGCGACAGCCCAAGTCACCAG
GAAGTACTCCCACTACCCCAACCTCCTCTCAAGCCCCACAGAAACTGGATGCTTCTGCAG
CTGCAGCCCCTGCCTCTCTGCCACCTTCATCACCTGCTGCTCCCATTGCCACTTTTTCTT
TGCTTCCTGCTGGTGGAGCCCCCACTGTGTTCTCCTTTGGTTCTTCATCTTTGAAGTCAT
CTGCTACGGTCACTGGGGAGCCCCCTTCATATTCCAGTGGCTCCGACAGCTCCAAAGCAG
CCCCAGGCCCTGGCCCATCAACCTTCTCTTTTGTTCCCCCTTCTAAAGCCTCCCTAGCCC
CCACCCCTGCAGCGTCTCCTGTGGCTCCATCAGCTGCTTCATTCTCCTTTGGATCATCTG
GTTTTAAGCCTACCCTGGAAAGCACACCAGTGCCAAGTGTGTCTGCTCCAAATATAGCAA
TGAAGCCCTCCTTCCCACCCTCAACCTCTGCTGTCAAAGTCAACCTTAGTGAAAAGTTTA
CTGCTGCAGCTACCTCTACTCCTGTTAGTAGCTCCCAGAGCGCACCCCCGATGTCGCCAT
TCTCTTCTGCCTCCAAGCCAGCTGCTTCTGGACCACTCAGCCACCCCACACCTCTCTCAG
CACCACCTAGTTCCGTGCCATTGAAGTCCTCAGTCTTGCCCTCACCATCAGCAGGACGAT
CTGCTCAGGGCAGTTCAAGCCCAGTGCCCTCAATGGTACAGAAATCACCCAGGATAACCC
CTCCAGCGGCAAAGCCAGGCTCTCCCCAGGCAAAGTCACTTCAGCCTGCTGTTGCAGAAA
AGCAGGGACATCAGTGGAAAGATTCAGATCCTGTAATGGCTGGAATTGGGGAGGAGATTG
CACACTTTCAGAAGGAGTTGGAAGAGTTAAAAGCCCGAACTTCCAAAGCCTGTTTCCAAG
TGGGCACTTCTGAGGAGATGAAGATGCTGCGAACAGAATCAGATGACTTGCATACCTTTC
TTTTGGAGATTAAAGAGACCACAGAGTCGCTTCATGGAGATATAAGTAGCCTGAAAACAA
CTTTACTTGAGGGCTTTGCTGGTGTTGAGGAAGCCAGAGAACAAAATGAAAGAAATCGTG
ACTCTGGTTATCTGCATTTGCTTTATAAAAGACCACTGGATCCCAAGAGTGAAGCTCAGC
TTCAGGAAATTCGGCGCCTTCATCAGTATGTGAAATTTGCTGTCCAAGATGTGAATGATG
TTCTAGACTTGGAGTGGGATCAGCATCTGGAACAAAAGAAAAAACAAAGGCACCTGCTTG
TGCCAGAGCGAGAGACACTGTTTAACACCCTAGCCAACAATCGGGAAATCATCAACCAAC
AGAGGAAGAGGCTGAATCACCTGGTGGATAGTCTTCAGCAGCTCCGCCTTTACAAACAGA
CTTCCCTGTGGAGCCTGTCCTCGGCTGTTCCTTCCCAGAGCAGCATTCACAGTTTTGACA
GTGACCTGGAAAGCCTGTGCAATGCTTTGTTGAAAACCACCATAGAATCTCACACCAAAT
CCTTGCCCAAAGTACCAGCCAAACTGTCCCCCATGAAACAGGCACAACTGAGAAACTTCT
TGGCCAAGAGGAAGACCCCACCAGTGAGATCCACTGCTCCAGCCAGCCTGTCTCGATCAG
CCTTTCTGTCTCAGAGATATTATGAAGACTTGGATGAAGTCAGCTCAACGTCATCTGTCT
CCCAGTCTCTGGAGAGTGAAGATGCACGGACGTCCTGTAAAGATGACGAGGCAGTGGTTC
AGGCCCCTCGGCACGCCCCCGTGGTTCGCACTCCTTCCATCCAGCCCAGTCTCTTGCCCC
ATGCAGCACCTTTTGCTAAATCTCACCTGGTTCATGGTTCTTCACCTGGTGTGATGGGAA
CTTCAGTGGCTACATCTGCTAGCAAAATTATTCCTCAAGGGGCCGATAGCACAATGCTTG
CCACGAAAACCGTGAAACATGGTGCACCTAGTCCTTCCCACCCCATCTCAGCCCCGCAGG
CAGCTGCCGCAGCAGCACTCAGGCGGCAGATGGCCAGTCAGGCACCAGCTGTAAACACTT
TGACTGAATCAACGTTGAAGAATGTCCCTCAAGTGGTAAATGTGCAGGAATTGAAGAATA
ACCCTGCAACCCCTTCTACAGCCATGGGTTCTTCAGTGCCCTACTCCACAGCCAAAACAC
CTCACCCAGTGTTGACCCCAGTGGCTGCTAACCAAGCCAAGCAGGGGTCTCTAATAAATT
CCCTTAAGCCATCTGGGCCTACACCAGCATCCGGTCAGTTATCATCTGGTGACAAAGCTT
CAGGGACAGCCAAGATAGAAACAGCTGTGACTTCAACCCCATCTGCTTCTGGGCAGTTCA
GCAAGCCTTTCTCATTTTCTCCATCAGGGACTGGCTTTAATTTTGGGATAATCACACCAA
CACCGTCTTCTAATTTCACTGCTGCACAAGGGGCAACACCCTCCACTAAAGAGTCAAGCC
AGCCGGACGCATTCTCATCTGGTGGGGGAAGCAAACCTTCTTATGAGGCCATTCCTGAAA
GCTCACCTCCCTCAGGAATCACATCCGCATCAAACACCACCCCAGGAGAACCTGCCGCAT
CTAGCAGCAGACCTGTGGCACCTTCTGGAACTGCTCTTTCCACCACCTCTAGTAAGCTGG
AAACCCCACCGTCCAAGCTGGGAGAGCTTCTGTTTCCAAGTTCTTTGGCTGGAGAGACTC
TGGGAAGTTTTTCAGGACTGCGGGTTGGCCAAGCAGATGATTCTACAAAACCAACCAATA
AGGCTTCATCCACAAGCCTAACTAGTACCCAGCCAACCAAGACGTCAGGCGTGCCCTCAG
GGTTTAATTTTACTGCCCCCCCGGTGTTAGGGAAGCACACGGAGCCCCCTGTGACATCCT
CTGCAACCACCACCTCAGTAGCACCACCAGCAGCCACCAGCACTTCCTCAACTGCCGTTT
TTGGCAGTCTGCCAGTCACCAGTGCAGGATCCTCTGGGGTCATCAGTTTTGGTGGGACAT
CTCTAAGTGCTGGCAAGACTAGTTTTTCATTTGGAAGCCAACAGACCAATAGCACAGTGC
CCCCATCTGCCCCACCACCAACTACAGCTGCCACTCCCCTTCCAACATCATTCCCCACAT
TGTCATTTGGTAGCCTCCTGAGTTCAGCAACTACCCCCTCCCTGCCTATGTCCGCTGGCA
GAAGCACAGAAGAGGCCACTTCATCAGCTTTGCCTGAGAAGCCAGGTGACAGTGAGGTCT
CAGCATCAGCAGCCTCACTTCTAGAGGAGCAACAGTCAGCCCAGCTTCCCCAGGCTCCTC
CGCAAACTTCTGACTCTGTTAAAAAAGAACCTGTTCTTGCCCAGCCTGCAGTCAGCAACT
CTGGCACTGCAGCATCTAGTACTAGTCTTGTAGCACTTTCTGCAGAGGCTACCCCAGCCA
CCACGGGGGTCCCTGATGCCAGGACGGAGGCAGTACCACCTGCTTCCTCCTTTTCTGTGC
CTGGGCAGACTGCTGTCACAGCAGCTGCTATCTCAAGTGCAGGCCCTGTGGCCGTCGAAA
CATCAAGTACCCCCATAGCCTCCAGCACCACGTCCATTGTTGCTCCCGGCCCATCTGCAG
AGGCAGCAGCATTTGGTACCGTCACTTCTGGCTCATCCGTCTTTGCTCAGCCTCCTGCTG
CCAGTTCTAGCTCAGCTTTCAACCAGCTCACCAACAACACAGCCACTGCCCCCTCTGCCA
CGCCCGTGTTTGGGCAAGTGGCAGCCAGCACCGCACCAAGTCTGTTTGGGCAGCAGACTG
GTAGCACAGCCAGCACAGCAGCTGCCACACCACAGGTCAGCAGCTCAGGGTTTAGCAGCC
CAGCTTTTGGTACCACAGCCCCAGGGGTCTTTGGACAGACAACCTTCGGGCAGGCCTCAG
TCTTTGGGCAGTCGGCGAGCAGTGCTGCAAGTGTCTTTTCCTTCAGTCAGCCTGGGTTCA
GTTCCGTGCCTGCCTTCGGTCAGCCTGCTTCCTCCACTCCCACATCCACCAGTGGAAGTG
TCTTTGGTGCCGCCTCAAGTACCAGTAGCTCCAGTTCCTTCTCATTTGGACAGTCTTCTC
CCAACACAGGAGGGGGGCTGTTTGGCCAAAGCAACGCTCCTGCTTTTGGGCAGAGTCCTG
GCTTTGGACAGGGAGGCTCTGTCTTTGGTGGTACCTCAGCTGCCACCACAACAGCAGCAA
CCTCTGGGTTCAGCTTTTGCCAAGCTTCAGGTTTTGGGTCTAGTAATACTGGTTCTGTGT
TTGGTCAAGCAGCCAGTACTGGTGGAATAGTCTTTGGCCAGCAATCATCCTCTTCCAGTG
GTAGCGTGTTTGGGTCTGGAAACACTGGAAGAGGGGGAGGTTTCTTCAGTGGCCTTGGAG
GAAAACCCAGTCAGGATGCAGCCAACAAAAACCCATTCAGCTCGGCCAGTGGGGGCTTTG
GATCCACAGCTACCTCAAATACCTCTAACCTATTTGGAAACAGTGGGGCCAAGACATTTG
GTGGATTTGCCAGCTCGTCGTTTGGAGAGCAGAAACCCACTGGCACTTTCAGCTCTGGAG
GAGGAAGTGTGGCATCCCAAGGCTTTGGGTTTTCCTCTCCAAACAAAACAGGTGGCTTCG
GTGCTGCTCCAGTGTTTGGCAGCCCTCCTACTTTTGGGGGATCCCCTGGGTTTGGAGGGG
TGCCAGCATTCGGTTCAGCCCCAGCCTTTACAAGCCCTCTGGGCTCGACGGGAGGCAAAG
TGTTCGGAGAGGGCACTGCAGCTGCCAGCGCAGGAGGATTCGGGTTTGGGAGCAGCAGCA
ACACCACATCCTTCGGCACGCTCGCGAGTCAGAATGCCCCCACTTTCGGATCACTGTCCC
AACAGACTTCTGGTTTTGGGACCCAGAGTAGCGGATTCTCTGGTTTTGGATCAGGCACAG
GAGGGTTCAGCTTTGGGTCAAATAACTCGTCTGTCCAGGGTTTTGGTGGCTGGCGAAGCT
GAGGGCGTGTCAGCAGGCCTTTCGATCCCTGGGACCAACCGCATCCTCAGCTTCTTCCCC
GAGAAATGCTGGAGCAGGCTGTTCAGACCGACGTTGCCATCAAAACACATACACCCAGAA
AGAAACAACAGAAACCAAAACTCACAAGGCGCATGATTACTTGTTTTATATTTCATGTTG
GGTTTTCCCTCCCACTATTAAACAGTCTGTTTCCGTACAGAACGTATGTGGGTTTTTTCA
GATCACAGCCAAGAAGATTGCCCCGTTTCTGTGGCTCTGAGAAGCCAGCAGAGCCTCCAT
CAGCCAGAACACTGTGTCTTCAAGGATGGCATCAGAAGTCACCAGCGTCGGGTGTTGATA
AACAGCATCGAATGTGCCGTGGTCTCACTTGGACCTAGCGCCCTCCACATAGGGAAGAGG
TTGAATGCTGGTGGGTCATCTTTTTGAGGCTGAAACTTGGTTATCTCCTCTCCTTGTTCT
TTTAGCCATTGTGTATCAGGACCATCCAAGGACGCACTCTGCGATTGAGTGGAGGCAGAG
GAAGCCACTCATGCCAGCAGCAGTTGAGTTTCAGAAGCAGCCATAGCGCTTTTCAGTACA
GTACAATAGTAGCCAGCGTGAGGCAGGACAGTGCTGCGCCTTAGCCGGCCTTGGCTCTCA
TCTCCATGTGGCTCTTGGGTGCCATGTGTCCTACTCCAGAGAGGAGGGGGCCGGTCACTT
GAGAAGACAGCCTTTATATTCTGTATGTGGCAGTGACATTGGTAGCCACACCTACCCAGT
GTCTACTAACCACAGTGCAGATAGCCCTTGGGTAGACCCAGGAAGTGTGAAGACAGACAC
TGCTGTTGCCAGACAACACTAGCAGAACGATGCTGGATTTGACAACAGTGTTTGCTAGGA
CGGCCCAGAGCTCATCACTGCAGTTTTATTAGAGTGCTTCTTTATCTTTAATGCAGTATC
TTTGAGGCCTGTAACATCCTAGATAGTTGCCATCAAACAAGGACCGTCTCGCATTGAAAA
CAGATGTAAGAATTTCTCTTTCAGGCCCAGAATCTGACAGTGCTTTGGCTTGGGTCATGA
GCAGCGGGGAGTTGGGAAGAGATTTTTTTTTTTAGAGTTTTACATATTGGCAGGTTGTAT
TTTTTTAATGTTTTAATAAAAGTTTGACATGACATTAA

Protein Sequence

>8021 : length: 2132
MRGQLRAAGAEGRKFAVERPGFRGQGRGRQRWLLRHTEGGAMGDEMDAMIPEREMKDFQF
RALKKVRIFDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNK
IVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEYGSIIAFFDVRTFSNEAKQQKRPF
AYHKLLKDAGGMVIDMKWNPTVPSMVAVCLADGSIAVLQVTETVKVCATLPSTVAVTSVC
WSPKGKQLAVGKQNGTVVQYLPTLQEKKVIPCPPFYESDHPVRVLDVLWIGTYVFAIVYA
AADGTLETSPDVVMALLPKKEEKHPEIFVNFMEPCYGSCTERQHHYYLSYIEEWDLVLAA
SAASTEVSILARQSDQINWESWLLEDSSRAELPVTDKSDDSLPMGVVVDYTNQVEITISD
EKTLPPAPVLMLLSTDGVLCPFYMINQNPGVKSLIKTPERLSLEGERQPKSPGSTPTTPT
SSQAPQKLDASAAAAPASLPPSSPAAPIATFSLLPAGGAPTVFSFGSSSLKSSATVTGEP
PSYSSGSDSSKAAPGPGPSTFSFVPPSKASLAPTPAASPVAPSAASFSFGSSGFKPTLES
TPVPSVSAPNIAMKPSFPPSTSAVKVNLSEKFTAAATSTPVSSSQSAPPMSPFSSASKPA
ASGPLSHPTPLSAPPSSVPLKSSVLPSPSAGRSAQGSSSPVPSMVQKSPRITPPAAKPGS
PQAKSLQPAVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQVGTSEEMK
MLRTESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGYLHLL
YKRPLDPKSEAQLQEIRRLHQYVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPERETLF
NTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFDSDLESLCN
ALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFLAKRKTPPVRSTAPASLSRSAFLSQRYY
EDLDEVSSTSSVSQSLESEDARTSCKDDEAVVQAPRHAPVVRTPSIQPSLLPHAAPFAKS
HLVHGSSPGVMGTSVATSASKIIPQGADSTMLATKTVKHGAPSPSHPISAPQAAAAAALR
RQMASQAPAVNTLTESTLKNVPQVVNVQELKNNPATPSTAMGSSVPYSTAKTPHPVLTPV
AANQAKQGSLINSLKPSGPTPASGQLSSGDKASGTAKIETAVTSTPSASGQFSKPFSFSP
SGTGFNFGIITPTPSSNFTAAQGATPSTKESSQPDAFSSGGGSKPSYEAIPESSPPSGIT
SASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLR
VGQADDSTKPTNKASSTSLTSTQPTKTSGVPSGFNFTAPPVLGKHTEPPVTSSATTTSVA
PPAATSTSSTAVFGSLPVTSAGSSGVISFGGTSLSAGKTSFSFGSQQTNSTVPPSAPPPT
TAATPLPTSFPTLSFGSLLSSATTPSLPMSAGRSTEEATSSALPEKPGDSEVSASAASLL
EEQQSAQLPQAPPQTSDSVKKEPVLAQPAVSNSGTAASSTSLVALSAEATPATTGVPDAR
TEAVPPASSFSVPGQTAVTAAAISSAGPVAVETSSTPIASSTTSIVAPGPSAEAAAFGTV
TSGSSVFAQPPAASSSSAFNQLTNNTATAPSATPVFGQVAASTAPSLFGQQTGSTASTAA
ATPQVSSSGFSSPAFGTTAPGVFGQTTFGQASVFGQSASSAASVFSFSQPGFSSVPAFGQ
PASSTPTSTSGSVFGAASSTSSSSSFSFGQSSPNTGGGLFGQSNAPAFGQSPGFGQGGSV
FGGTSAATTTAATSGFSFCQASGFGSSNTGSVFGQAASTGGIVFGQQSSSSSGSVFGSGN
TGRGGGFFSGLGGKPSQDAANKNPFSSASGGFGSTATSNTSNLFGNSGAKTFGGFASSSF
GEQKPTGTFSSGGGSVASQGFGFSSPNKTGGFGAAPVFGSPPTFGGSPGFGGVPAFGSAP
AFTSPLGSTGGKVFGEGTAAASAGGFGFGSSSNTTSFGTLASQNAPTFGSLSQQTSGFGT
QSSGFSGFGSGTGGFSFGSNNSSVQGFGGWRS