ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

80139

Name

ZNF703

Synonym

NLZ1|ZEPPO1|ZNF503L|ZPO1;zinc finger protein 703;ZNF703;zinc finger protein 703

Definition

zinc finger elbow-related proline domain protein 1

Position

8p11.23

Gene Type

protein-coding

External Links

Links to cell senescence gene database

80139

Links to epithelial mesenchymal transition gene database

80139

Links to ovarian cancer gene database

80139

Links to endometrial cancer gene database

80139

Links to iHOP

80139

Sequence Information

Nucleotide Sequence

>80139 : length: 3380
GCTATTTGACGTGCGGCTCGAGGAAGGCGAAGGTTTTTGTGTTGCTAGCCGGGGCCAGCG
GCGGTGGCGGCGGCGGCGGAGGCGTCGGTGGAGGAGGGGAGGCGGCGAGGAGGCGCAGCT
CCCGCTGCACCGCGATCGACGCTGCGGAGCGAGCCCACCCGCCCCGGGAGCTCGCCTCCC
CGGTGCTCCCCCGCCCTCCCCGCCCCCCCAGCGGCGCTGCCTCCTCCAAATGAGCGATTC
GCCCGCTGGATCTAACCCAAGGACACCCGAAAGCAGCGGCAGCGGCAGCGGCGGCGGCGG
GAAGAGGCCGGCGGTGCCGGCAGCGGTGTCCCTCTTGCCACCGGCGGACCCCCTGCGCCA
GGCGAACCGGCTCCCGATCAGGGTCCTGAAGATGCTGAGCGCTCACACCGGTCACCTCCT
GCACCCGGAGTACCTGCAGCCGCTGTCCTCCACTCCCGTCAGCCCCATTGAGCTGGACGC
CAAGAAGAGCCCCTTGGCGCTGCTGGCTCAGACCTGCTCGCAGATCGGCAAGCCGGACCC
GCCGCCCTCCTCCAAACTCAACTCGGTGGCGGCGGCGGCCAACGGGCTGGGAGCGGAGAA
GGACCCCGGCCGCTCAGCCCCGGGCGCCGCCTCCGCAGCCGCGGCCCTGAAGCAGCTGGG
GGACTCACCGGCCGAGGACAAGTCCAGCTTCAAGCCCTACTCCAAGGGCTCCGGCGGCGG
CGACTCCCGCAAAGACAGCGGCTCCTCCTCGGTGTCTTCCACCTCCTCCTCGTCCTCCTC
GTCCCCGGGAGACAAGGCGGGCTTCAGGGTCCCCAGCGCCGCCTGCCCGCCCTTTCCCCC
GCATGGAGCGCCGGTCTCCGCATCCTCGTCCTCGTCGTCGCCCGGCGGCTCCCGCGGCGG
CTCCCCGCACCACTCTGACTGCAAGAACGGCGGCGGGGTTGGCGGCGGGGAGCTGGACAA
GAAAGACCAGGAGCCCAAGCCCAGCCCGGAGCCGGCAGCCGTGAGCCGCGGCGGCGGTGG
GGAGCCCGGGGCGCACGGTGGCGCCGAGTCCGGGGCCTCCGGGCGCAAGTCCGAGCCGCC
CTCGGCGCTGGTGGGGGCCGGCCACGTGGCGCCGGTGTCTCCCTACAAGCCGGGCCACTC
GGTGTTCCCGCTGCCGCCCTCCAGCATTGGCTACCACGGCTCCATCGTGGGCGCCTACGC
CGGCTACCCGTCTCAGTTCGTGCCTGGCCTGGATCCTAGCAAGTCCGGCCTCGTGGGAGG
CCAGCTGTCTGGGGGCCTGGGCCTGCCGCCGGGCAAGCCCCCCAGCTCCAGCCCGCTCAC
CGGGGCCTCCCCGCCCTCCTTCCTGCAGGGATTATGCCGCGACCCCTATTGCTTGGGAGG
TTACCACGGCGCCTCGCACCTCGGCGGCTCCAGCTGCTCCACCTGCAGCGCGCACGACCC
TGCCGGGCCCAGCCTGAAGGCGGGGGGCTACCCGCTGGTGTACCCCGGGCACCCGCTGCA
GCCCGCCGCGCTCTCGTCCAGCGCCGCCCAGGCCGCGCTCCCCGGCCACCCGCTCTACAC
CTACGGCTTCATGCTGCAGAACGAACCGCTGCCGCACAGCTGCAACTGGGTGGCAGCCAG
TGGGCCGTGCGACAAGCGCTTCGCCACCTCGGAGGAGCTGCTCAGCCACCTACGGACCCA
CACGGCCCTGCCGGGAGCCGAGAAACTTCTGGCCGCCTACCCCGGGGCCTCGGGCCTGGG
CAGCGCCGCCGCCGCCGCCGCCGCCGCCGCCTCCTGCCATCTGCACCTCCCCCCGCCCGC
CGCCCCCGGCAGCCCCGGGTCGCTGTCCTTGCGGAATCCACACACTTTGGGCCTAAGCCG
GTACCACCCCTATGGCAAGAGCCACTTATCCACAGCGGGGGGCCTGGCCGTGCCGTCCCT
CCCCACAGCCGGACCCTACTATTCGCCATACGCGCTGTATGGACAGAGACTAGCTTCAGC
CTCGGCGCTGGGATACCAGTAACTACAGCTCTTCCTCCACCCCAGCCCCCTCACCCTCCT
CCCTCTCCCTCCTCCTCCCTCCCCACCTGCCGTCGCCGCTGCAACCTCCACTACTGCTTG
ACCCTGCCGGGATTCCCCACCCAGCCCTTCCCCACCGGACTGTGTATTTATTTACTATAA
TGTTAGCTTACAAGCTGGGAATATAAGTGCATTAACGGCCCACATGAGTCAATGGTATGC
AAAAAGTCTGTGTTCTCCCAAATAATAATATTAATCCCACAAATAACGACATGATCCCCG
CCCCTGTTCCTTTCTGTTATTTTTTCTTAGATATAAGTTTTACATTTTTTATTCCTTTTC
CTCTTTTTTTGGTTTTGATTGGTTTGGTTTGAGGGAGAGTTGGGGTCTTTGGGTTCTTCT
AGACGTTTTGTTTTCCCTTCCTGGGGAGTTTCTTGCATGAGTCTTAACTTAAAACTACGT
TTCCGCCTTCTCTTTTTCCCTCTTCCCCCTTCATTCCCTCTTGTTTCCTTCCATTTGCGG
TTCTGTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTTTCCTTTGTTGTACAAGTAACAG
AGAGGAGGTTTTTTTTGTAACTCATTTTGGGGGTGGAGGGGGCCACCTGGGTGGCAGGGG
CCCTGGAGCTCTATTGACCTGGTACACTGCTCCGGGACTCCTCCCCCGCCACCCTCCGCG
CATAGGGTCCTTGGTCTGGACCCTGCCCCCCAAAAGTAGGGCCTTGCTCCTCTACCTTGC
TCTGAGCACGGAGAGCCCTGACCCCACCAGTAGGCTCGCCCCCAGAAGGGCCCAAGTGGC
CGTCTACCGTCACCTTCCAGACTCCCGCCCCTAACACCCAGTGGCTACAGTGCGCCTGTC
GGGGCACCTGGAGCGCTCACCTGGTTGAATTCAAAGTCCCAGAAGGCCCCGCTGGCGTGA
AGCCGGCCCCTTACATTTTGCGAAGTGCATTATAGTCCTTGTTTTTCTCTCCCTCGTGGG
GGCAACGACCCCTCCCCTGGCAGTAGGGGTGGGGTAGGTGACTCTCGCTAGATCCCTCCA
AAGCAGACCGGTGGCGATGTCAGCGGATGTCACGAGCTCGTTAGCTGCGTTCGGGGAAGG
TTGGGGCGTCAGGGAGCTCTCGGATCACAGCAGCCCCCGCCCTCTCCTAGGCCTGGCCCG
GCAGAGCCCCCAGAGTGGACCCCCCAGCGACTGGGGTCTTCTCCCCACTCCTCCCTCCTT
CTGGTCTGATGCGGCAGCGCGGGGGCTGCGGGGCCTGTTTGGGACGAACAGAGCTCTCCC
TTGGTAAGACTTATTTTGTTAATAAATGGAATACTTGGCTATATTCACAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAA

Protein Sequence

>80139 : length: 590
MSDSPAGSNPRTPESSGSGSGGGGKRPAVPAAVSLLPPADPLRQANRLPIRVLKMLSAHT
GHLLHPEYLQPLSSTPVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLNSVAAAANGL
GAEKDPGRSAPGAASAAAALKQLGDSPAEDKSSFKPYSKGSGGGDSRKDSGSSSVSSTSS
SSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSSSPGGSRGGSPHHSDCKNGGGVGGG
ELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRKSEPPSALVGAGHVAPVSPYK
PGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGLGLPPGKPPSS
SPLTGASPPSFLQGLCRDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSLKAGGYPLVYPG
HPLQPAALSSSAAQAALPGHPLYTYGFMLQNEPLPHSCNWVAASGPCDKRFATSEELLSH
LRTHTALPGAEKLLAAYPGASGLGSAAAAAAAAASCHLHLPPPAAPGSPGSLSLRNPHTL
GLSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ