ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

79923

Name

NANOG

Synonym

Nanog homeobox;NANOG;Nanog homeobox

Definition

homeobox protein NANOG|homeobox transcription factor Nanog|homeobox transcription factor Nanog-delta 48

Position

12p13.31

Gene Type

protein-coding

External Links

Links to cell senescence gene database

79923

Links to epithelial mesenchymal transition gene database

79923

Links to ovarian cancer gene database

79923

Links to endometrial cancer gene database

79923

Links to iHOP

79923

Sequence Information

Nucleotide Sequence

>79923 : length: 2103
TTCATTATAAATCTAGAGACTCCAGGATTTTAACGTTCTGCTGGACTGAGCTGGTTGCCT
CATGTTATTATGCAGGCAACTCACTTTATCCCAATTTCTTGATACTTTTCCTTCTGGAGG
TCCTATTTCTCTAACATCTTCCAGAAAAGTCTTAAAGCTGCCTTAACCTTTTTTCCAGTC
CACCTCTTAAATTTTTTCCTCCTCTTCCTCTATACTAACATGAGTGTGGATCCAGCTTGT
CCCCAAAGCTTGCCTTGCTTTGAAGCATCCGACTGTAAAGAATCTTCACCTATGCCTGTG
ATTTGTGGGCCTGAAGAAAACTATCCATCCTTGCAAATGTCTTCTGCTGAGATGCCTCAC
ACGGAGACTGTCTCTCCTCTTCCTTCCTCCATGGATCTGCTTATTCAGGACAGCCCTGAT
TCTTCCACCAGTCCCAAAGGCAAACAACCCACTTCTGCAGAGAAGAGTGTCGCAAAAAAG
GAAGACAAGGTCCCGGTCAAGAAACAGAAGACCAGAACTGTGTTCTCTTCCACCCAGCTG
TGTGTACTCAATGATAGATTTCAGAGACAGAAATACCTCAGCCTCCAGCAGATGCAAGAA
CTCTCCAACATCCTGAACCTCAGCTACAAACAGGTGAAGACCTGGTTCCAGAACCAGAGA
ATGAAATCTAAGAGGTGGCAGAAAAACAACTGGCCGAAGAATAGCAATGGTGTGACGCAG
AAGGCCTCAGCACCTACCTACCCCAGCCTTTACTCTTCCTACCACCAGGGATGCCTGGTG
AACCCGACTGGGAACCTTCCAATGTGGAGCAACCAGACCTGGAACAATTCAACCTGGAGC
AACCAGACCCAGAACATCCAGTCCTGGAGCAACCACTCCTGGAACACTCAGACCTGGTGC
ACCCAATCCTGGAACAATCAGGCCTGGAACAGTCCCTTCTATAACTGTGGAGAGGAATCT
CTGCAGTCCTGCATGCAGTTCCAGCCAAATTCTCCTGCCAGTGACTTGGAGGCTGCCTTG
GAAGCTGCTGGGGAAGGCCTTAATGTAATACAGCAGACCACTAGGTATTTTAGTACTCCA
CAAACCATGGATTTATTCCTAAACTACTCCATGAACATGCAACCTGAAGACGTGTGAAGA
TGAGTGAAACTGATATTACTCAATTTCAGTCTGGACACTGGCTGAATCCTTCCTCTCCCC
TCCTCCCATCCCTCATAGGATTTTTCTTGTTTGGAAACCACGTGTTCTGGTTTCCATGAT
GCCCATCCAGTCAATCTCATGGAGGGTGGAGTATGGTTGGAGCCTAATCAGCGAGGTTTC
TTTTTTTTTTTTTTTCCTATTGGATCTTCCTGGAGAAAATACTTTTTTTTTTTTTTTTTT
TGAAACGGAGTCTTGCTCTGTCGCCCAGGCTGGAGTGCAGTGGCGCGGTCTTGGCTCACT
GCAAGCTCCGTCTCCCGGGTTCACGCCATTCTCCTGCCTCAGCCTCCCGAGCAGCTGGGA
CTACAGGCGCCCGCCACCTCGCCCGGCTAATATTTTGTATTTTTAGTAGAGACGGGGTTT
CACTGTGTTAGCCAGGATGGTCTCGATCTCCTGACCTTGTGATCCACCCGCCTCGGCCTC
CCTAACAGCTGGGATTTACAGGCGTGAGCCACCGCGCCCTGCCTAGAAAAGACATTTTAA
TAACCTTGGCTGCCGTCTCTGGCTATAGATAAGTAGATCTAATACTAGTTTGGATATCTT
TAGGGTTTAGAATCTAACCTCAAGAATAAGAAATACAAGTACAAATTGGTGATGAAGATG
TATTCGTATTGTTTGGGATTGGGAGGCTTTGCTTATTTTTTAAAAACTATTGAGGTAAAG
GGTTAAGCTGTAACATACTTAATTGATTTCTTACCGTTTTTGGCTCTGTTTTGCTATATC
CCCTAATTTGTTGGTTGTGCTAATCTTTGTAGAAAGAGGTCTCGTATTTGCTGCATCGTA
ATGACATGAGTACTGCTTTAGTTGGTTTAAGTTCAAATGAATGAAACAACTATTTTTCCT
TTAGTTGATTTTACCCTGATTTCACCGAGTGTTTCAATGAGTAAATATACAGCTTAAACA
TAA

Protein Sequence

>79923 : length: 305
MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDL
LIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYL
SLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSS
YHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPF
YNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNM
QPEDV