ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

79872

Name

CBLL1

Synonym

HAKAI|RNF188;Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase;CBLL1;Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase

Definition

Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1|Cbl proto-oncogene, E3 ubiquitin protein ligase-like 1|E-cadherin binding protein E7|E3 ubiquitin-protein ligase Hakai|RING finger protein 188|c-Cbl-like protein 1|casitas B-lineage lymph

Position

7q22.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

79872

Links to epithelial mesenchymal transition gene database

79872

Links to ovarian cancer gene database

79872

Links to endometrial cancer gene database

79872

Links to iHOP

79872

Sequence Information

Nucleotide Sequence

>79872 : length: 5046
GCGTGGGTCTAGGTAGCTCGTCACGACAAAGCAAAATTTAGACAAGCGTTGAGACTTTCC
TTCTAGCTCCGAGTTTCACAGCTCCGCCATCCCCTGAGCAACCTCCCACTGGAGGGCGCC
TTCCGGAGCGCGCGTGTTTACACTTTTGCTACACCAGGCGGAGGAAACAAGCGCTCGCTG
ACCCCGGGGGATTCCAAACCGTTACTCCGCCCGCCGGGGTGGGGCCAGCGCAACGGCCGA
GCCTGCGCAGCCAGCCGGCTCCGGGGGCCCCGCGCACTACAAGTCCCAGAAGGCAGCTCT
CCGCGGGGCGGGCAGTCGCCTTATCTGCTTCTGGCTCATTTTTACCACTGCTCTCCCCTT
CCCCGGTCCCCCTGGTGTCCTTTCCACAGTTAAAGGCTACTTTCTCTTGAAGCACATGAG
GAGAAGCCTTAGCAACCTCAATACCGAAGTTCTTCGCGCGCTCGCTCTTTCTGCCTCCGC
CCGAACTATGCCTGAGTCCCTCACAGGAGTTGGATAGTAGAGGCGAGAGAAGGAAGTCTT
TGCAGGCCAAAATTGGGACAACCTGCTTGGACTTCCGCCTCCCGGCCTCCGGAAGGCAGT
GCGCACGCGCTCGCTGCGACTCCGGCGCGGTTGACTTCCGCTCCCACTGTGCTCTGCGAG
CCGAATCATGGATCACACTGACAATGAGTTACAAGGCACTAATAGTTCTGGATCCTTGGG
TGGTCTTGATGTTCGCAGACGAATTCCTATAAAGCTCATCTCCAAACAAGCAAACAAAGC
GAAACCTGCACCGCGAACTCAAAGAACTATAAACAGGATGCCTGCAAAGGCTCCACCTGG
TGATGAAGTTCTAGGGCCAAAAGAGTCGTGAGAAGCCTGGCTCCTTGGAGGGATATATTT
GTCTGCTCAGCTTTACTTTAGGATTTGATTATAATGAAGAAGAACGGTATGACTGTAAAG
GGGGTGAGCTGTTTGCAAATCAGCGAAGATTTCCTGGACACCTTTTTTGGGACTTTCAGA
TAAACATCTTAGGTGAAAAGGATGATACACCAGTTCATTTCTGTGACAAGTGTGGATTGC
CTATTAAAATCTATGGGAGAATGATTCCATGCAAGCATGTTTTTTGCTATGACTGTGCTA
TTTTACATGAAAAAAAGGGAGATAAGATGTGTCCAGGCTGTAGTGATCCTGTGCAGCGAA
TTGAGCAGTGTACACGAGGTTCTCTCTTCATGTGTAGCATTGTTCAAGGGTGCAAGAGAA
CATATTTGTCTCAGAGAGACTTACAGGCTCATATCAACCATCGCCATATGAGAGCTGGAA
AACCTGTTACCCGTGCTTCACTTGAAAATGTTCATCCTCCTATTGCCCCACCACCAACTG
AAATCCCTGAGCGTTTTATAATGCCACCAGACAAGCACCATATGAGCCATATTCCGCCAA
AGCAGCACATCATGATGCCACCACCTCCTTTGCAACATGTGCCACATGAGCACTATAATC
AGCCACATGAGGATATTCGTGCTCCTCCAGCAGAATTGTCCATGGCTCCACCTCCACCTC
GATCGGTCAGTCAGGAAACCTTTCGTATTTCAACAAGAAAACACAGCAATTTAATAACCG
TCCCTATTCAGGATGACTCAAATTCAGGTGCTAGAGAACCACCACCTCCTGCCCCAGCAC
CTGCTCACCATCATCCTGAATATCAGGGTCAACCAGTGGTATCGCACCCTCATCATATTA
TGCCTCCACAGCAACATTATGCACCACCCCCACCTCCTCCACCACCAATAAGCCATCCAA
TGCCACATCCTCCCCAGGCTGCAGGTACTCCTCACTTGGTATATAGCCAAGCTCCACCTC
CACCAATGACCTCTGCTCCACCACCAATAACCCCTCCCCCTGGACATATTATTGCCCAGA
TGCCACCTTATATGAATCATCCTCCTCCAGGACCTCCCCCACCTCAACATGGTGGTCCAC
CTGTAACTGCACCCCCTCCTCACCATTATAATCCTAACTCATTACCCCAGTTCACTGAAG
ATCAAGGAACTCTGAGCCCTCCATTTACACAACCAGGGGGAATGAGTCCTGGTATATGGC
CTGCACCAAGAGGGCCACCACCACCTCCACGATTGCAGGGTCCGCCTTCTCAAACCCCAC
TTCCTGGACCACATCATCCAGATCAGACAAGATATAGACCGTATTACCAATGATAATAGT
ATTTTGAATGGAAGATATGAGGGGGAAAAAAACTTATGTGTAGTCAATCTTTTAAGCTTT
GACTGTTTTGGGAAGGAAGAGTACCTCTTATCGAGGTAGTATAAAACACATAGGGTCTTG
TTTCTTAAAATGGTTTTAAATCTTGACCTTAAGATTGATTTCAAGTACCATACTGTAGTA
CAGATAAGTGGCTCAGTTGAGCACAGCTATATTTTAACATCTCTTTGTTCCCCTAGTTTA
GTAAATTGACCCAGAGGTGACCATTTGTAAAAAATTTGAAAAAATTTTTCATTGTTTTAC
TTCAAAAGTATTGTTTTGTTAAACCCAACGTTTAGTTTTTCTTGTGATACATTTTGTTAA
CCTGTGTAAAAGGATTAAATTTCAATATGGTTGTAAAAATGCTATTTTTATGTGAATTTA
AGTGCAGCCACATACTGTTTTTTAAACCATATGTTTTACCACTAATTTCCCAAAGTTATA
ATAAAATCCTGAAAGTAAAAATCTACTAGAATTTGCTGTAAGGCAGACTGTTAAATGATA
GAGAATTATTTCACATTTTAGGCACTGAAATGTTGAGGTTTCGAGGTATAGTAAGTATAC
AATGCACTTCACTTGGATGCCTTTTCATTTTTAGGCAGCCTCAGGAGCACCAAAATACAT
TGGAATTCTAGTACTAAGATATATTTGTTCGTAATGTTAAAAGACATTACTAATTATTTG
GAAAGAGATGGCCAAAATAATCAACTCTACAGGCTTCAAGCTGGTGGGGGAATGCTGTTA
CTCATTAATGCTTTTTTACTGAATGGTCGGAATCACATATGCACCACACATACTGATCTT
AAGTAACATTATTTTATAGAACTGTTTAAATGGGTTTAAATGGTGTTCTTTAGATGAAAT
GTGTTCTGTTTTGTTCATTGTCTTAAACTGAATAGGGCTGAATAGGCTTTATGTAATTCT
TCATTTCATGGTAGAGTTTGATGCTGTGTTTAAGTGGGTTCTTGTTTATAGGATTTTCAA
CTACAGTTTGAATGCCATGGAGGAATTTGAATAATATATTAATGAAGGACATATTCTTGT
AATCACAAATTTGCATTTGCTCAGGTTTCATTGCTGTGTGATAGGATTTTTCCTCTAACT
TGAAATTTAAAAACTTTTATTTCCTATTCCTTTTGTCGGTAAAGCAGTCTGAATTTGGAA
CATTTTATCATGGAGTCAACAGTGAAGACTACCAGATAATTTTGTATTGGAGAAGAGGAA
ATAACAGCTAAATTGTGGATTTCAGTGCTTTACATGGTGCCTTTCGAGTCAGCTTTTACA
TTATAGGGGCTTGTTATAGTTTAGCTAAGATGACCACTTAACAGTTTATACAGAACTCAT
ATGTATAAATCAACATTCTTAGGATATTATTTATATCCTTTGAATAAATCCCTGTGAAGT
TTTTCCTCCCCACTAAAATGGTGCATAATAAAACATGAAATATGTAGTATGCAGATATCA
TTTATTAGATAGTTTGTAGTGTATACATTTAGAACATACTTCTTTTGACAAAGGGTGATC
TGATTGCTAATTTACCATTTTATTCTGTCAGGTACAGGTGAAACAAATTCTCATCTTGAA
TGATCAGATGCAAAATCATTTCTGAACCCTAGAGCAGAAGTTAGAAATAACAAAATGGCC
GTTTCAACCTTGACTGGCCAAAAATAACTAATAAACTTTTTTGTTTTAAGTCAGGCAAGT
GATTTTCTACATTTAGCAGTTTGAAAGTCCAGTGTTAATGCAATATTTCTAGTGAGAAAT
GCTTGTTATTAAAAGCATGGGAGTGATAGTGTGAAATGGTGGTGAGTGCTTCTATCATAT
TACTGTAGGTACTTGGACTGGTGCAAACTTGATTCCTTTTCATCCCCCTGTTTAGGAGCT
ATTAAAATATTACTGTTAAAAATCCAAACCATTCTTTGTTCCATGTAATAAGAAAATAGC
CAAAATCACTTTAGAGCTTCTCAACTATTTATGAAGAGCTATCCTGCTTTTATTGAAAGT
CACTAGAGTTGAATGTGGTAAGAAACCACTTAGCCTATGTATTGGACGAGAAAATCAGTA
TCATGATAAAATTTTGAATTAAGAGAACCCTTGTAGAGTTTTTAAAAAATGATTTATTTT
CAATTAGGTTTAAGAAATCTATGTTATGCAGGGAGGCATATCAGATGAATGTTGTAGCAG
ACAAAAGTTTTAAATCGTGTTAGACTTGAATTCATCAATTGTTTGAATGAGGGTGGGTGG
GTAGAAGGATAACAAAATTACTGTTAGTGTTTCTTTCCTTACGGAAAAAGATGTGAATCC
CAGCCTTATTTCAGGGAAGCCTTTGAAGCTATGATGGACATAAGTCTAAATTAAATGTAT
GTATGTTTCATTATATTGCTCTTAAGACTACTGAGGTGGCAGTTTAATTCTTAAAAACAA
TAAAATGGAAGCATAAATACTATTTTGCCTAGATGAATTTTTATGTTTTGGCACATCTGG
GAGAATGCAGAATTTTCCATGTTTATATTGATACAACTTTCTACAGTAAAAGTAAGTTCA
CTTCTAAAAGATTAAAACCATCAAGTTGAATGTCATATTTCTTCATTGGCATGTTTATTC
AGAGTATAATACAGTATTTGGGGAAATATCTGTTGCAAAGACTGTAAGAAACTATATTCA
TTTTGCCTTGTAAAAACTACTTGCTCAAAATTATCATGTAAATACTAATTAGATACCACT
GAAATGTAAATGGAAGAGATACTTGAACATATCTTTTAAAGTCAATAAGAGGCTGTATGA
AGTATA

Protein Sequence

>79872 : length: 491
MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDE
EGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGEKDDTPVHFCDKCGLPIKIYG
RMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQR
DLQAHINHRHMRAGKPVTRASLENVHPPIAPPPTEIPERFIMPPDKHHMSHIPPKQHIMM
PPPPLQHVPHEHYNQPHEDIRAPPAELSMAPPPPRSVSQETFRISTRKHSNLITVPIQDD
SNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMPHPPQ
AAGTPHLVYSQAPPPPMTSAPPPITPPPGHIIAQMPPYMNHPPPGPPPPQHGGPPVTAPP
PHHYNPNSLPQFTEDQGTLSPPFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHH
PDQTRYRPYYQ