ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

79870

Name

BAALC

Synonym

brain and acute leukemia, cytoplasmic;BAALC;brain and acute leukemia, cytoplasmic

Definition

brain and acute leukemia cytoplasmic protein

Position

8q22.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

79870

Links to epithelial mesenchymal transition gene database

79870

Links to ovarian cancer gene database

79870

Links to endometrial cancer gene database

79870

Links to iHOP

79870

Sequence Information

Nucleotide Sequence

>79870 : length: 2859
GCGGAGAGGAGGGACGGGCTGGGAGAGGGCCCGGACTAGGGGCGGCGGGCACCGCAGGAG
CTCCGCGCGGCTGCAGCGCGGGCGGGAGCGGGGACGCGATGTCGCCGCCGCCGCCTCCTT
GCGGGCCGGGGCTGCGCCTCCGGGGCTGAGCCGCCGCCAGAGCCGACAGCCGAGCAGCCG
CTGGGCGCTCCCGCGGCGCAGGAGGATGGGCTGCGGCGGGAGCCGGGCGGATGCCATCGA
GCCCCGCTACTACGAGAGCTGGACCCGGGAGACAGAATCCACCTGGCTCACCTACACCGA
CTCGGACGCGCCGCCCAGCGCCGCCGCCCCGGACAGCGGCCCCGAAGCGGGCGGCCTGCA
CTCGGGCATGCTGGAAGATGGACTGCCCTCCAATGGTGTGCCCCGATCTACAGCCCCAGG
TGGAATACCCAACCCAGAGAAGAAGACGAACTGTGAGACCCAGTGCCCAAATCCCCAGAG
CCTCAGCTCAGGCCCTCTGACCCAGAAACAGAATGGCCTTCAGACCACAGAGGCTAAAAG
AGATGCTAAGAGAATGCCTGCAAAAGAAGTCACCATTAATGTAACAGATAGCATCCAACA
GATGGACAGAAGTCGAAGAATCACAAAGAACTGTGTCAACTAGCAGAGAGTCCAAGCAGA
AGGGCAGATGGACTTCTTCAGTGTCCTTCACGGCACTGGATCCCATCAAAGAACCTTGAA
GAAGTGGCTGCCCCTTGCTGGACCTGAATTCTACTGAGTCCCTGGCAAGACTGTCTTACC
TGGCAGCAAACTGCTGCCTGATTTGTTGGGACCTTCTGAGCCTTCTACTTATCATGTAAA
TGTATTGGCACAGTGCTTACATATGTTAATAAACTGCAAATGTGCAGTTCAGTTTGTCTC
TTTGCAACTCCTGTAATACGGTCTGGTGTAAAAGTAGTGAGTTAAAGCTACAGGTCAGTT
TATGAAACAGAAAAGTAGGAATGCATTTTCTGGGTGAAAGAGTCACACCTTAGTGCTATA
ACTCTCCTGCCCATGATAGTGTATTCTGTTTCAGGCAAGCTTATTCTTTCCTTCTTTCAT
TTTAAATATTGTCATTACAAATCTTACCAGGTTCACTTAAAAGCTGGCTTTCATCCAACT
CTAAACCCACATATTGAAAAAATCAAGGTACAGGAAAACTCCTTGTTATCCTTGTTTCCT
TAGCTTGGTATGAGACAGATCGGATCCAGTTTCCCATGCACCAACCCACTGCCCATGGCA
TGTCTTTGGGAGGTGTCTGTGAAGCAGTCATACCTGCTCCTCATCTGCCTGGAAAGTCCT
CCTATTCCAGTGTCCATGTTGGCCTCCAGTCCTTAATGTCACCATGCTTGTGGCCAATGC
ATCCAAATAAGGATACCCCTCAGGGCTCAGCTAGACATTGCAATTTTGCATAGCTTTCCA
GTTCCCTTTGCTTGTCTTCTTGACTGTCTTCCCTCTCTATCGGGGTCACTTGCAATTGTT
AATCAAAGATTGAACACTGCGTAGGAGAGGGAGATGATCCAGAGACATGTGGCAGCAGGC
ATGGCTTCCCCTTGGCCTCTCTGTACACTGCCCCAGGACTGTCATTTTGGCATCTGCAAA
GGAATCACTTTAGAAAGCCAGCACCTGGTTGATGTGTATTCATACTGACATTAGATTGAT
GTGCACTGCATTAGAAATGAGGTAGCTGACACAGAAAAAGGATGTTTTGATAGGAATAAT
TTTCTAGTATGTCTTGAAACATGTTCATCTGGAAGTATTTTCCTCCAAAGTAATGTAGCA
TGATTTTTCAAGGATTGTTAACATGCCTGGGATTGGGAAAGATAGGACTAAAGTTGTGCC
AAACTATATCAATAAATTCCATGTTTAGCAGAAATAGGCAGCCTATTGGTGTTATGTTTA
TGTAACATAGTCCAGAGAACTGACATGCAGGTCAAAAGTCAGATACGCAACCTCCTTATC
TGCTAACTCTGTTATTCTTCAAACACAAGTGGGTAGTGTCATTTTTCCTTCCTTCCTTCC
ATTGGCAGATTGTATATTTATTCACAAAACATTAAATGTCCATCCTGTGCCAGGTACTAT
GCAGATGTTGAGGGATTTGGGGTCTGGTTAGTCGTGACTATCTATCCTGAATCTAACAGT
GACTTCATAACTAGGAGACTGAATTAGACCCTTAAGGTATAGTGTGTGTTGCAAATCACT
CTGCAATGGAAACTTTTATATTCAGGGTAGGTTTGTGTCTTAAACTAGGTGTTCTAATCA
ATGTACAAGACTTTACCATACACGCAACTATAGTTTTTCTAAACCTTCATCATTTTGTGA
TTCTTTGAGAAAGGGCTTTTAGGAACTTTATGTTCTAAAAAATGTTTTTAACAATAATAA
GATAAAAGAAAAACCTGTGATTCATATGTCCCCACTGGCATTACTCAGCAGGAGCCCCCA
GCTGCCAAAGGTTGGCAGTGATCCTGCAAGTTCAAGGGCTCTTTCTCCCTGGGGATGTGC
TTTGTGGCTTCTCTTTACAGCTTTGTTTCTGCATCAGTTCACTGCTGCATGTTGTTTGGA
ATTTATCACCTTAAGAAAGTGTCTCTGTTTTATATAGAAACACTTTCTCACTTACAGGGG
AGAAGGAAATGCAGGGCACATGATCTGGCCCTCCCCAGAACAATCTGGATTTCACGGAGA
CAGCAACCAGAAGTTAAACCATGTGACTAAAAATGCATCTGGCTACTTTTTCATGTATGT
ATGAGACAGAAACTAATCCTTACTATCCTATTAGGATACCACTTTTCATTGCAAAGTTTG
TGTCAATAAAGTCATTAATTTTAAACATAAAAAAAAAAA

Protein Sequence

>79870 : length: 145
MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSGMLEDGL
PSNGVPRSTAPGGIPNPEKKTNCETQCPNPQSLSSGPLTQKQNGLQTTEAKRDAKRMPAK
EVTINVTDSIQQMDRSRRITKNCVN