ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7984

Name

ARHGEF5

Synonym

GEF5|P60|TIM|TIM1;Rho guanine nucleotide exchange factor (GEF) 5;ARHGEF5;Rho guanine nucleotide exchange factor (GEF) 5

Definition

ephexin-3|guanine nucleotide regulatory protein TIM|oncogene TIM|p60 TIM|rho guanine nucleotide exchange factor 5|transforming immortalized mammary oncogene

Position

7q35

Gene Type

protein-coding

Pathways and Diseases

Pathway

rho cell motility signaling pathway;PID BioCarta;100041

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

pkc-catalyzed phosphorylation of inhibitory phosphoprotein of myosin phosphatase;PID BioCarta;100100

Pathway

rac1 cell motility signaling pathway;PID BioCarta;100056

External Links

Links to cell senescence gene database

7984

Links to epithelial mesenchymal transition gene database

7984

Links to ovarian cancer gene database

7984

Links to endometrial cancer gene database

7984

Links to iHOP

7984

Sequence Information

Nucleotide Sequence

>7984 : length: 5505
GCGGGTGGGGCGGCCGGGCCTGCGCTGGGGACGGCTCTGGGGACTGCGGCCGGCGCCGGG
ACCTGGAGGGGACGCTGGGGCCGAAGCAGCATGTGACACCGACCAGGATTCAGCCCTGAT
GGAGGCTGAGGAGGCCCAGCGTGGAGCCTCTCCTCCCATCTCTGCCATAGAGGAATTCAG
CATTATCCCTGAGGCTCCCATGAGGAGCAGCCAGGTCTCTGCCTTGGGGCTTGAAGCTCA
AGAAGATGAGGACCCATCCTATAAGTGGAGAGAGGAACACAGACTCTCAGCAACTCAGCA
GAGTGAGTTAAGGGATGTGTGTGACTATGCGATTGAGACGATGCCCTCTTTTCCCAAGGA
AGGTTCTGCAGATGTGGAGCCCAATCAGGAAAGCCTTGTGGCTGAGGCCTGTGACACTCC
GGAACACTGGGAGGCAGTACCCCAGAGCCTAGCAGGCCGACAAGCAAGGACTCTAGCTCC
CCCAGAGCTCTGGGCCTGCCCCATTCAGAGTGAGCATCTAGACATGGCCCCATTTTCCAG
TGACCTGGGAAGCGAAGAAGAGGAGGTGGAATTTTGGCCAGGACTTACTTCTTTGACATT
GGGATCTGGACAGGCAGAAGAAGAAGAGGAAACCTCTTCAGATAACTCTGGTCAGACCAG
ATATTATTCTCCCTGCGAAGAGCATCCTGCAGAGACCAACCAGAATGAAGGCTCTGAAAG
TGGGACTATCAGGCAGGGGGAAGAGCTGCCACCTGAGGAGCTGCAGGAAAGTCAAGGGCT
CTTGCATCCCCAGGAGGTCCAAGTTCTGGAGGAGCAGGGACAGCAGGAAGCAGGATTTCG
GGGGGAAGGAACTCTGAGGGAGGATGTTTGTGCCGATGGGCTATTAGGGGAGGAACAGAT
GATAGAGCAGGTTAATGATGAAAAGGGAGAACAGAAGCAAAAACAGGAACAGGTACAAGA
TGTGATGCTTGGGAGACAAGGAGAAAGAATGGGGCTCACTGGGGAGCCAGAGGGTCTGAA
TGACGGTGAGTGGGAGCAGGAGGATATGGAGAGGAAGGCTCAGGGTCAGGGAGGTCCAGA
ACAGGGAGAAGAGAGGAAGAGGGAGCTGCAGGTGCCAGAAGAGAATAGGGCGGACTCTCA
GGACGAAAAGAGTCAAACCTTTTTGGGAAAATCAGAGGAAGTAACTGGAAAGCAAGAAGA
TCATGGTATAAAGGAGAAAGGGGTGCCAGTCAGCGGGCAGGAGGCGAAAGAGCCAGAGAG
TTGGGATGGGGGCAGGCTGGGGGCAGTGGGAAGAGCGAGGAGCAGGGAAGAGGAGAATGA
GCATCATGGGCCTTCAATGCCCGCTCTGATAGCCCCTGAGGACTCTCCTCACTGTGACCT
GTTTCCAGGTGCCTCATATCTCATGACTCAGATTCCCGGGACTCAGACAGAGTCCAGGGC
TGAGGAACTGTCCCCCGCAGCTCTGTCTCCCTCGCTAGAGCCCATCAGGTGCTCTCACCA
GCCCATTTCTCTACTGGGCTCCTTTTTGACTGAGGAGTCACCTGACAAGGAAATAGATCA
AAACAGCCAGCAAGAGGAATCCAGGCTGAGGAAGGGAACAGTGTCCAGCCAAGGGACTGA
GGTGGTCTTTGCCAGTGCATCTGTGACTCCTCCAAGGACACCAGATTCAGCTCCTCCCAG
TCCTGCTGAAGCCTACCCCATCACACCTGCCTCGGTATCTGCCAGGCCCCCAGTTGCCTT
TCCCAGGAGGGAAACCTCTTGTGCTGCACGTGCTCCAGAAACTGCCAGTGCCCCTCTCTC
AATGGATGACCCATCTCCCTGTGGGACTTCTGAGATGTGCCCGGCTGCCCTCTATGGCTT
CCCCTCCACCGGGACCAGCCCTCCGAGGCCCCCAGCCAACTCCACAGGCACCGTCCAGCA
CTTACGGAGTGACTCCTTCCCTGGTTCTCACAGGACAGAGCAGACTCCAGACCTGGTGGG
AATGTTGCTTTCCTACTCCCACTCAGAGCTGCCCCAGAGGCCCCCCAAACCTGCCATCTA
CAGCTCTGTGACCCCAAGAAGGGACAGAAGGAGTGGTAGGGACTACAGCACCGTTTCAGC
ATCCCCTACTGCCTTATCCACGCTGAAGCAGGACTCTCAAGAATCCATCTCAAATCTAGA
GAGACCCAGCAGTCCTCCCAGCATCCAGCCCTGGGTCTCCCCACATAATCCAGCCTTTGC
CACAGAGTCTCCCGCCTACGGTTCTTCCCCATCCTTTGTCTCCATGGAGGATGTGAGGAT
CCACGAACCTCTGCCCCCTCCTCCCCCACAGAGGAGGGACACCCATCCCTCCGTGGTGGA
GACAGATGGCCATGCTCGTGTAGTGGTTCCCACGCTGAAGCAGCATAGCCACCCTCCTCC
ATTGGCCCTAGGTTCAGGGCTGCATGCCCCCCATAAAGGCCCACTTCCCCAAGCCTCTGA
CCCCGCTGTGGCCAGGCAGCACCGACCTCTGCCATCTACCCCAGACAGCTCCCACCATGC
TCAGGCCACCCCCAGGTGGAGATACAACAAGCCGCTACCCCCTACCCCTGATTTGCCGCA
GCCCCACCTTCCTCCCATTTCTGCTCCTGGTAGCTCAAGGATCTACAGGCCTCTACCCCC
ACTACCCATCATAGACCCTCCCACCGAACCACCCCCATTGCCCCCAAAGTCCAGGGGGAG
GAGCAGGAGCACTCGGGGAGGACATATGAACTCAGGGGGTCATGCCAAAACAAGACCTGC
TTGTCAAGACTGGACAGTCCCCCTCCCTGCCTCTGCTGGACGCACCTCCTGGCCCCCGGC
CACAGCTAGATCAACAGAGTCTTTCACTTCCACCAGCAGGAGTAAGAGCGAAGTGTCCCC
TGGCATGGCTTTCAGCAACATGACAAACTTCCTATGCCCCTCTTCCCCTACCACTCCCTG
GACTCCGGAGCTCCAGGGACCCACCTCTAAGGATGAAGCAGGGGTCTCAGAACACCCTGA
GGCCCCTGCGAGAGAACCTTTGAGAAGGACAACCCCTCAGCAAGGAGCCAGTGGCCCAGG
GAGGTCACCTGTGGGCCAAGCAAGGCAGCCAGAAAAACCCAGCCATCTGCACCTGGAGAA
GGCGTCCAGCTGGCCCCACAGGCGGGACTCAGGGAGGCCACCAGGGGACAGCAGTGGACA
GGCTGTGGCTCCTAGTGAGGGGGCCAACAAGCACAAGGGCTGGAGCCGGCAGGGCCTGCG
CAGACCTTCCATCTTGCCTGAGGGCTCTTCAGATTCAAGAGGTCCAGCCGTGGAGAAACA
TCCGGGACCCTCAGACACTGTTGTTTTTCGGGAGAAAAAACCAAAGGAGGTGATGGGAGG
CTTTTCAAGACGCTGCTCCAAACTCATCAACTCCTCCCAGCTGCTTTACCAGGAGTATAG
TGATGTTGTCCTGAATAAGGAGATCCAGAGCCAGCAGCGGCTGGAGAGCCTGTCCGAGAC
ACCCGGGCCTAGCTCTCCGCGGCAGCCTCGGAAGGCCCTGGTCTCCTCCGAGTCGTACCT
GCAGCGGCTCTCCATGGCCTCCAGCGGCTCCCTCTGGCAGGAAATCCCCGTGGTGCGCAA
CAGCACCGTGCTGCTCTCCATGACCCATGAAGACCAAAAGCTGCAAGAGGTCAAATTTGA
GCTGATTGTGTCAGAGGCCTCCTACCTGCGCAGTCTAAACATAGCTGTGGATCATTTCCA
ACTTTCAACTTCACTCCGGGCCACACTTTCCAACCAGGAGCACCAATGGCTCTTCTCTCG
TTTACAGGATGTGCGAGACGTCAGCGCCACGTTCCTTTCAGACCTGGAAGAGAACTTTGA
GAACAATATCTTCTCCTTCCAAGTATGTGACGTAGTCCTGAACCACGCCCCAGACTTCCG
CCGGGTCTACCTGCCTTATGTCACCAACCAGACCTATCAGGAACGCACCTTCCAGAGCCT
GATGAATAGCAACAGCAATTTCCGGGAGGTCTTGGAGAAGCTGGAGAGCGACCCCGTCTG
CCAGCGCCTTTCCCTCAAGTCCTTTCTGATTCTGCCCTTCCAACGCATCACCCGCCTCAA
ACTGCTGCTCCAGAACATTCTGAAGAGAACACAGCCTGGCTCCTCGGAGGAGGCAGAGGC
CACGAAGGCACACCACGCCCTGGAGCAGCTGATCCGGGACTGCAATAACAATGTCCAGAG
TATGCGACGGACAGAGGAACTAATCTACCTGAGCCAGAAGATTGAGTTTGAGTGCAAAAT
ATTCCCGCTCATTTCTCAGTCACGCTGGCTGGTGAAAAGTGGGGAGCTGACAGCCTTGGA
GTTCAGTGCTTCCCCAGGGCTACGAAGGAAGCTGAACACGCGTCCAGTCCACCTGCACCT
CTTCAATGACTGTCTGCTGCTGTCTCGGCCCCGAGAGGGTAGCCGATTCCTGGTATTTGA
CCATGCTCCCTTCTCCTCCATTCGGGGGGAAAAGTGTGAAATGAAGCTACATGGACCTCA
CAAAAACCTGTTCCGACTCTTTCTGCGGCAGAACACTCAGGGCGCCCAGGCCGAGTTCCT
CTTCCGCACGGAGACTCAAAGTGAAAAGCTTCGGTGGATCTCAGCCTTGGCCATGCCAAG
AGAGGAGTTGGACCTTCTGGAGTGTTACAACTCCCCCCAGGTACAGTGCCTTCGAGCCTA
CAAGCCCCGAGAGAATGATGAATTGGCACTGGAGAAAGCCGACGTGGTGATGGTGACTCA
GCAGAGCAGTGACGGCTGGCTGGAGGGCGTGAGGCTCTCAGACGGGGAGCGAGGCTGGTT
TCCTGTGCAGCAGGTGGAGTTCATTTCCAACCCAGAGGTCCGTGCACAGAACCTGAAGGA
AGCTCATCGAGTCAAGACTGCCAAACTACAGCTGGTGGAACAGCAAGCCTAAGTCTTCTC
TGAGAGGAGTTTCGTGAGCTGAAGAACAAGCTGCTCATGGCAAGGGCTGGCCCCAGAACC
CTGCAAGAGAGGCCTTCTGTGGATGGAGAACTAGGCCTTCTCAAAGCTCAAGGACAAAAT
CCAGCTAACCCAGTCCCTCGGCCCAGGCCTCCTTTCGTGCTTTGTGCTTGGTGGGGGGGA
TTTCGAGGGACTTTGCACTGGACTCTGGGAACCTTTCATCATTAAAAAAAGGGGGACCAT
TGGGGCCTGAGCCAAGGAACTTTCCTTCTACTGCCTTATAGTGCTTAAACATTCTCCGCC
TCCAGGGTGCAGATTCAGAGCTGGCCAGAGTTTCAGTGATAGCCGTATGTTAAACAGAAT
CTCACCTCAGTCTCCTGGAGGGAGATGTTTAAGAGGGGTTAACACATCAGATGGGAGGGT
CAGCCCGGTGACCTCTAAGGTATCTTCTAACCTAGAAATTCACCATAATTATGGTGCAAG
GTCAGTGTGTCTCTGAGATCTATGTCTGTTGGTGGCAATGTGAGGGTGATACTCTCTCAC
TCTAATAAACTTGGCACTTCTCCGAGTAAAAAAAAAAAAAAAAAA

Protein Sequence

>7984 : length: 1597
MEAEEAQRGASPPISAIEEFSIIPEAPMRSSQVSALGLEAQEDEDPSYKWREEHRLSATQ
QSELRDVCDYAIETMPSFPKEGSADVEPNQESLVAEACDTPEHWEAVPQSLAGRQARTLA
PPELWACPIQSEHLDMAPFSSDLGSEEEEVEFWPGLTSLTLGSGQAEEEEETSSDNSGQT
RYYSPCEEHPAETNQNEGSESGTIRQGEELPPEELQESQGLLHPQEVQVLEEQGQQEAGF
RGEGTLREDVCADGLLGEEQMIEQVNDEKGEQKQKQEQVQDVMLGRQGERMGLTGEPEGL
NDGEWEQEDMERKAQGQGGPEQGEERKRELQVPEENRADSQDEKSQTFLGKSEEVTGKQE
DHGIKEKGVPVSGQEAKEPESWDGGRLGAVGRARSREEENEHHGPSMPALIAPEDSPHCD
LFPGASYLMTQIPGTQTESRAEELSPAALSPSLEPIRCSHQPISLLGSFLTEESPDKEID
QNSQQEESRLRKGTVSSQGTEVVFASASVTPPRTPDSAPPSPAEAYPITPASVSARPPVA
FPRRETSCAARAPETASAPLSMDDPSPCGTSEMCPAALYGFPSTGTSPPRPPANSTGTVQ
HLRSDSFPGSHRTEQTPDLVGMLLSYSHSELPQRPPKPAIYSSVTPRRDRRSGRDYSTVS
ASPTALSTLKQDSQESISNLERPSSPPSIQPWVSPHNPAFATESPAYGSSPSFVSMEDVR
IHEPLPPPPPQRRDTHPSVVETDGHARVVVPTLKQHSHPPPLALGSGLHAPHKGPLPQAS
DPAVARQHRPLPSTPDSSHHAQATPRWRYNKPLPPTPDLPQPHLPPISAPGSSRIYRPLP
PLPIIDPPTEPPPLPPKSRGRSRSTRGGHMNSGGHAKTRPACQDWTVPLPASAGRTSWPP
ATARSTESFTSTSRSKSEVSPGMAFSNMTNFLCPSSPTTPWTPELQGPTSKDEAGVSEHP
EAPAREPLRRTTPQQGASGPGRSPVGQARQPEKPSHLHLEKASSWPHRRDSGRPPGDSSG
QAVAPSEGANKHKGWSRQGLRRPSILPEGSSDSRGPAVEKHPGPSDTVVFREKKPKEVMG
GFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQRLESLSETPGPSSPRQPRKALVSSESY
LQRLSMASSGSLWQEIPVVRNSTVLLSMTHEDQKLQEVKFELIVSEASYLRSLNIAVDHF
QLSTSLRATLSNQEHQWLFSRLQDVRDVSATFLSDLEENFENNIFSFQVCDVVLNHAPDF
RRVYLPYVTNQTYQERTFQSLMNSNSNFREVLEKLESDPVCQRLSLKSFLILPFQRITRL
KLLLQNILKRTQPGSSEEAEATKAHHALEQLIRDCNNNVQSMRRTEELIYLSQKIEFECK
IFPLISQSRWLVKSGELTALEFSASPGLRRKLNTRPVHLHLFNDCLLLSRPREGSRFLVF
DHAPFSSIRGEKCEMKLHGPHKNLFRLFLRQNTQGAQAEFLFRTETQSEKLRWISALAMP
REELDLLECYNSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDGERGW
FPVQQVEFISNPEVRAQNLKEAHRVKTAKLQLVEQQA