ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7965

Name

AIMP2

Synonym

JTV-1|JTV1|P38|PRO0992;aminoacyl tRNA synthetase complex-interacting multifunctional protein 2;AIMP2;aminoacyl tRNA synthetase complex-interacting multifunctional protein 2

Definition

ARS-interacting multi-functional protein 2|aminoacyl tRNA synthase complex-interacting multifunctional protein 2|multisynthase complex auxiliary component p38|multisynthetase complex auxiliary component p38|protein JTV-1

Position

7p22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cytosolic tRNA aminoacylation;PID Reactome;500660

Pathway

Gene Expression;Reactome;REACT:71

External Links

Links to cell senescence gene database

7965

Links to epithelial mesenchymal transition gene database

7965

Links to ovarian cancer gene database

7965

Links to endometrial cancer gene database

7965

Links to iHOP

7965

Sequence Information

Nucleotide Sequence

>7965 : length: 1363
GAGTTTCATCATGTTGTCCTCTCGAACTCCTGACCTCAAGTGATCCACCCGCCTCGCCCT
TCCAAAGTGCTGAGATTACAGGTATCAGCCACTGTGCCTAGCCAGCACTCAATAATTTAA
TTGGCATACTGAACTCTGTTCCACCCGGAAGTCAGTGGACTTCACATTTCTCTGACGTTT
GATCTTAAATAAGAGCAGCAGACTAGGAGAGGTGAGAAAGTGCTGATTAAGCCCGAAGGT
AAATAGGAGTTAAGCAAACAAGAGAAGAAGGAAGAGTGATGCAGATGGAGGGAACAGCAC
ATGTGAAGATCTGTGGTCAGAGCCAGGGTGGTGGTTTAGGAACTCCTCGGACAGTGTGGC
TAGAGCACAGGCAAAGGACGAAATTGGGTGAGGAAGAGTCTAACCTGTCTCTGCAAGCTC
TTGAGTCCCGCCAAGATGATATTTTAAAACGTCTGTATGAGTTGAAAGCTGCAGTTGATG
GCCTCTCCAAGATGATTCAAACACCAGATGCAGACTTGGATGTAACCAACATAATCCAAG
CGGATGAGCCCACGACTTTAACCACCAATGCGCTGGACTTGAATTCAGTGCTTGGGAAGG
ATTACGGGGCGCTGAAAGACATCGTGATCAACGCAAACCCGGCCTCCCCTCCCCTCTCCC
TGCTTGTGCTGCACAGGCTGCTCTGTGAGCACTTCAGGGTCCTGTCCACGGTGCACACGC
ACTCCTCGGTCAAGAGCGTGCCTGAAAACCTTCTCAAGTGCTTTGGAGAACAGAATAAAA
AACAGCCCCGCCAAGACTATCAGCTGGGATTCACTTTAATTTGGAAGAATGTGCCGAAGA
CGCAGATGAAATTCAGCATCCAGACGATGTGCCCCATCGAAGGCGAAGGGAACATTGCAC
GTTTCTTGTTCTCTCTGTTTGGCCAGAAGCATAATGCTGTCAACGCAACCCTTATAGATA
GCTGGGTAGATATTGCGATTTTTCAGTTAAAAGAGGGAAGCAGTAAAGAAAAAGCCGCTG
TTTTCCGCTCCATGAACTCTGCTCTTGGGAAGAGCCCTTGGCTCGCTGGGAATGAACTCA
CCGTAGCAGACGTGGTGCTGTGGTCTGTACTCCAGCAGATCGGAGGCTGCAGTGTGACAG
TGCCAGCCAATGTGCAGAGGTGGATGAGGTCTTGTGAAAACCTGGCTCCTTTTAACACGG
CCCTCAAGCTCCTTAAGTGAATTGCCGTAACTGATTTTAAAGGGTTTAGATTTTAAGAAT
GGTGCTCTTTCATGCCTATTATCAGTAAGGGGACTTGTATTAGAGTCAGAGTCTTTTTAT
TTAGGCCAGTTGTCAAGTGTCAATAAAAGCATCATGTAATTTA

Protein Sequence

>7965 : length: 320
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQD
DILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALK
DIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQD
YQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIA
IFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQ
RWMRSCENLAPFNTALKLLK