ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

79366

Name

HMGN5

Synonym

NBP-45|NSBP1;high mobility group nucleosome binding domain 5;HMGN5;high mobility group nucleosome binding domain 5

Definition

high mobility group nucleosome-binding domain-containing protein 5|high-mobility group nucleosome binding domain 5|nucleosomal binding protein 1|nucleosome-binding protein 1

Position

Xq13.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

79366

Links to epithelial mesenchymal transition gene database

79366

Links to ovarian cancer gene database

79366

Links to endometrial cancer gene database

79366

Links to iHOP

79366

Sequence Information

Nucleotide Sequence

>79366 : length: 2126
AATAGCACCGCGAGATCTGTTGAAACATTGATTTTTGACGATTCCTTCCCTGAGAAGAGG
GCGAGGAGAAGAAGAAAGAAAAAGGAGAACTGAATTGAATTAGATTAGCATGAAGGACCT
TTTCACGCGGAGACTAAAAGTACTGCGCATAACTTCCTGCTCAGAAATATATGCAAATAA
GAAGACAGATCCTGAAAGAGCAAGCTAGGAGAGTACAGGTCGTGCTGCAGTTAGTTCATT
GAAAACTCATTTGCTCTTGGAGCAGTCAGGCAGTGACTGCCTTCGGCTTTTTTTCTGCTG
ACTAAGATCTCCTATAGAGAGCTACAACAATGCCCAAAAGAAAGGCTGCAGGTCAAGGTG
ATATGAGGCAGGAGCCAAAGAGAAGATCTGCCAGGTTGTCTGCTATGCTTGTGCCAGTTA
CACCAGAGGTGAAGCCTAAAAGAACATCAAGTTCAAGGAAAATGAAGACAAAAAGTGATA
TGATGGAAGAAAACATAGATACAAGTGCCCAAGCAGTTGCTGAAACCAAGCAAGAAGCAG
TTGTTGAAGAAGACTACAATGAAAATGCTAAAAATGGAGAAGCCAAAATTACAGAGGCAC
CAGCTTCTGAAAAAGAAATTGTGGAAGTAAAAGAAGAAAATATTGAAGATGCCACAGAAA
AGGGAGGAGAAAAGAAAGAAGCAGTGGCAGCAGAAGTAAAAAATGAAGAAGAAGATCAGA
AAGAAGATGAAGAAGATCAAAACGAAGAGAAAGGGGAAGCTGGAAAAGAAGACAAAGATG
AAAAAGGGGAAGAAGATGGAAAAGAGGATAAAAATGGAAATGAGAAAGGAGAAGATGCAA
AAGAGAAAGAAGATGGAAAAAAAGGTGAAGACGGAAAAGGAAATGGAGAAGATGGAAAAG
AGAAAGGAGAAGATGAAAAAGAGGAAGAAGACAGAAAAGAAACAGGAGATGGAAAAGAGA
ATGAAGATGGAAAAGAGAAGGGAGATAAAAAAGAGGGGAAAGATGTAAAAGTCAAAGAAG
ATGAAAAAGAGAGAGAAGATGGAAAAGAAGATGAAGGTGGAAATGAGGAAGAAGCTGGAA
AAGAGAAAGAAGATTTAAAAGAAGAGGAAGAAGGAAAAGAGGAAGATGAGATCAAAGAAG
ATGATGGAAAAAAAGAGGAGCCACAGAGTATTGTTTAAAACTGCCCTATGTAGTTTCATA
ATTTGGTAACATGTACCTTCATGTTGTAAAGTTAATAGAGATAAATATTTTTATCAAAAA
TTTTATAAACACAGCCTTTCTTTAGCATTGATTTAATTTCAGAACATCTTCATATTGATT
ATTAGCCATAAAGTTTCTAACATGAAACATTTATCTATAAATTTTGTGATTATAGTAGTG
GAATACATAGAAAAAAATATGCTTTCAACTTTGTGAGTGAATTTCGTGTTGTGTAAGTTA
TATGTCAAATCTTTGAATTTTAATTTTACTCTTTTATACATGTGATAATTTCATAAAGTG
AGGGATCCCAAAAAAAGAGTTTCATCCAACATTCTTGTTCTGCAGGTTGCTTTTATAAAG
AAGGTGAACTATTTTCATGTAATGTTAAGAGTTAAACTTATCTTTCCCAAATATAACTTT
ATTATTAGCTTGGGAAAAATGAAATTGTATTCCCATTTTTAAAATAAATACAAATGTTTA
TTTCAGAAGGGCAGTTTTGATTATATGTGAATACACAAATTTTACTGGATTTATCTTAAT
AAAAAGACTCTGACGATGATTGTGTTTTGTTATATCTTCAAAAATATAGCTAGTGAAATA
TTGTGCTTAATTTTTTTCTATTGTGTTATTCATGAAAATATTTAATATTCACTGACATAA
AATTAATATAAAGTAAAATTCACCATTTTAATTATAATAAAAATAAAGTATATAATTCAA
TGGTTGTCAGTATATTCACAATGTTGTGTCCACTGTTTAATTCCAGAGAATTTTTATCAC
CCAAATAAGAAACAAAGCACCAATTAGCAGTCTCTTCCCATTTTCGCCCAACTTATCCCC
CACCTCCATCCCTTGGCAACCACTAATCTGCCTTCTATCTCTATGGATTTGCCTATTCTG
AACATTTATTATAAATGGAATCACAT

Protein Sequence

>79366 : length: 283
MPKRKAAGQGDMRQEPKRRSARLSAQMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTS
AQAVAETKQEAVVEEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAV
AAEVKNEEEDQKEDEEDQNEEKGEAGKEDKDEKGEEDGKEDKNGNEKGEDAKEKEDGKKG
EDGKGNGEDGKEKGEDEKEEEDRKETGDGKENEDGKEKGDKKEGKDVKVKEDEKEREDGK
EDEGGNEEEAGKEKEDLKEEEEGKEEDEIKEDDGKKEEPQSIV