ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7913

Name

DEK

Synonym

D6S231E;DEK proto-oncogene;DEK;DEK proto-oncogene

Definition

DEK oncogene (DNA binding)|protein DEK

Position

6p22.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

7913

Links to epithelial mesenchymal transition gene database

7913

Links to ovarian cancer gene database

7913

Links to endometrial cancer gene database

7913

Links to iHOP

7913

Sequence Information

Nucleotide Sequence

>7913 : length: 2879
CATTCCCGCTCTCCTTCCCGAACCGCCATTTTGAAAATCTTGTTGATTCTGGGGAGCCGA
GCGCGCGGCGCGAGCGTCACGCCAGACAGCGGCCCGCGCGCCTTCTCCTCGGCGTCGGCC
GCCGCCGCCTCCCAGAACCTCCTCGTGCCCTCGCGTGCCAGGCCCGCGGCGGCCGAAATC
CGCGGTTCACAGCATGTCCGCCTCGGCCCCTGCTGCGGAGGGGGAGGGAACCCCCACCCA
GCCCGCGTCCGAGAAAGAACCCGAAATGCCCGGTCCCAGAGAGGAGAGCGAGGAGGAAGA
GGACGAGGACGACGAGGAGGAGGAGGAGGAGGAAAAAGAAAAGAGTCTCATCGTGGAAGG
CAAGAGGGAAAAGAAAAAAGTAGAGAGGTTGACAATGCAAGTCTCTTCCTTACAGAGAGA
GCCATTTACAATTGCACAAGGAAAGGGGCAGAAACTTTGTGAAATTGAGAGGATACATTT
TTTTCTAAGTAAGAAGAAAACCGATGAACTTAGAAATCTACACAAACTGCTTTACAACAG
GCCAGGCACTGTGTCCTCATTAAAGAAGAATGTGGGTCAGTTCAGTGGCTTTCCATTTGA
AAAAGGAAGTGTCCAATATAAAAAGAAGGAAGAAATGTTGAAAAAATTTAGAAATGCCAT
GTTAAAGAGCATCTGTGAGGTTCTTGATTTGGAGAGATCAGGTGTAAATAGTGAACTAGT
GAAGAGGATCTTGAATTTCTTAATGCATCCAAAGCCTTCTGGCAAACCATTGCCGAAATC
TAAAAAAACTTGTAGCAAAGGCAGTAAAAAGGAACGGAACAGTTCTGGAATGGCAAGGAA
GGCTAAGCGAACCAAATGTCCTGAAATTCTGTCAGATGAATCTAGTAGTGATGAAGATGA
AAAGAAAAACAAGGAAGAGTCTTCAGATGATGAAGATAAAGAAAGTGAAGAGGAGCCACC
AAAAAAGACAGCCAAAAGAGAAAAACCTAAACAGAAAGCTACTTCTAAAAGTAAAAAATC
TGTGAAAAGTGCCAATGTTAAGAAAGCAGATAGCAGCACCACCAAGAAGAATCAAAACAG
TTCCAAAAAAGAAAGTGAGTCTGAGGATAGTTCAGATGATGAACCTTTAATTAAAAAGTT
GAAGAAACCCCCTACAGATGAAGAGTTAAAGGAAACAATAAAGAAATTACTGGCCAGTGC
TAACTTGGAAGAAGTCACAATGAAACAGATTTGCAAAAAGGTCTATGAAAATTATCCTAC
TTATGATTTAACTGAAAGAAAAGATTTCATAAAAACAACTGTAAAAGAGCTAATTTCTTG
AGATAGAGGACAGAGAAGATGACTCGTTCCCATAGATTTGAAGATCTGATTTATACCATT
ATACCAGCAAAGAGAATGTATTTCCTTTTCTAAATCCTTGTTAAGCAACGTTAGTAGAAC
TTACTGCTGACCTTTTTATCTTGAGTGTTATGTGAATTTGAGTTTGCTGTTTTAAATTGC
ATTTCTATGCCATTTTTAGTTTAAAATCTTGCATGGCATTAATTGTTCCTTGCTTTTATA
GTTGTATTTTGTACATTTTGGATTTCTTTATATAAGGTCATAGATTCTTGAGCTGTTGTG
GTTTTTAGTGCACTTAATATTAGCTTGCTTAAGGCATACTTTTAATCAAGTAGAACAAAA
ACTATTATCACCAGGATTTATACATACAGAGATTGTAGTATTTAGTATATGAAATATTTT
GAATACACATCTCTGTCAGTGTGAAAATTCAGCGGCAGTGTGTCCATCATATTAAAAATA
TACAAGCTACAGTTGTCCAGATCACTGAATTGGAACTTTTCTCCTGCATGTGTATATATG
TCAAATTGTCAGCATGACAAAAGTGACAGATGTTATTTTTGTATTTTTAAAAAACAATTG
GTTGTATATAAAGTTTTTTTATTTCTTTTGTGCAGATCACTTTTTAAACTCACATAGGTA
GGTATCTTTATAGTTGTAGACTATGGAATGTCAGTGTTCAGCCAAACAGTATGATGGAAC
AGTGAAAGTCAATTCAGTGATGGCAACACTGAAGGAACAGTTACCCTGCTTTGCCTCGAA
AGTGTCATCAATTTGTAATTTTAGTATTAACTCTGTAAAAGTGTCTGTAGGTACGTTTTA
TATTATATAAGGACAGACCAAAAATCAACCTATCAAAGCTTCAAAAACTTTGGGAAAGGG
TGGGATTAAGTACAAGCACATTTGGCTTACAGTAAATGAACTGATTTTTATTAACTGCTT
TTGCCCATATAAAATGCTGATATTTACTGGAAACCTAGCCAGCTTCACGATTATGACTAA
AGTACCAGATTATAATGCCAGAATATAATGTGCAGGCAATCGTGGATGTCTCTGACAAAG
TGTGTCTCAAAAATAATATACTTTTACATTAAAGAAATTTAATGTTTCTCTGGAGTTGGG
GCTCTTGGCTTTCAGAGTTTGGTTAATCAGTGTTGATTCTAGATGATCAACATAATGGAC
CACTCCTGAATGAGACTTAATTTTGTCTTTCAAATTTACTGTCTTAAATCAGTTTATTAA
ATCTGAATTTTAAAACATGCTGTTTATGACACAATGACACATTTGTTGCACCAATTAAGT
GTTGAAAAATATCTTTGCATCATAGAACAGAAATATATAAAAATATATGTTGAATGTTAA
CAGGTATTTTCACAGGTTTGTTTCTTGATAGTTACTCAGACACTAGGGAAAGGTAAATAC
AAGTGAACAAAATAAGCAACTAAATGAGACCTAATAATTGGCCTTCGATTTTAAATATTT
GTTCTTATAAACCTTGTCAATAAAAATAAATCTAAATCACTGGTGTTTTAAAAAAAAAA

Protein Sequence

>7913 : length: 375
MSASAPAAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEGKREK
KKVERLTMQVSSLQREPFTIAQGKGQKLCEIERIHFFLSKKKTDELRNLHKLLYNRPGTV
SSLKKNVGQFSGFPFEKGSVQYKKKEEMLKKFRNAMLKSICEVLDLERSGVNSELVKRIL
NFLMHPKPSGKPLPKSKKTCSKGSKKERNSSGMARKAKRTKCPEILSDESSSDEDEKKNK
EESSDDEDKESEEEPPKKTAKREKPKQKATSKSKKSVKSANVKKADSSTTKKNQNSSKKE
SESEDSSDDEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLT
ERKDFIKTTVKELIS