ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

79058

Name

ASPSCR1

Synonym

ASPCR1|ASPL|ASPS|RCC17|TUG|UBXD9|UBXN9;alveolar soft part sarcoma chromosome region, candidate 1;ASPSCR1;alveolar soft part sarcoma chromosome region, candidate 1

Definition

UBX domain protein 9|UBX domain-containing protein 9|alveolar soft part sarcoma chromosomal region candidate gene 1 protein|alveolar soft part sarcoma locus|renal cell carcinoma gene on chromosome 17|renal cell carcinoma, papillary, 17|renal papillary cel

Position

17q25.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

79058

Links to epithelial mesenchymal transition gene database

79058

Links to ovarian cancer gene database

79058

Links to endometrial cancer gene database

79058

Links to iHOP

79058

Sequence Information

Nucleotide Sequence

>79058 : length: 2140
GCTGCGGCCCCGCCCCCTGGCCGCGTGGCTGCGCGTCCTGGCTGTTGCCGATAAAGTTGT
TTGACGCCGGCCCGGCGGCGGGTCACGTGAGCGGAAAATGGCGGCCCCGGCAGGCGGCGG
AGGCTCCGCGGTGTCGGTGCTGGCCCCGAACGGCCGGCGCCACACGGTGAAGGTGACGCC
GAGCACCGTGCTGCTTCAGGTTCTGGAGGACACGTGCCGGCGGCAGGACTTCAACCCCTG
TGAATATGATCTGAAGTTTCAGAGGAGCGTGCTCGACCTTTCTCTCCAGTGGAGATTTGC
CAACCTGCCCAACAATGCCAAGCTGGAGATGGTGCCCGCTTCCCGGAGCCGTGAGGGGCC
TGAGAACATGGTTCGCATCGCTTTGCAGCTGGACGATGGCTCGAGGTTGCAGGACTCTTT
CTGTTCAGGCCAGACCCTCTGGGAGCTTCTCAGCCATTTTCCACAGATCAGGGAGTGCCT
GCAGCACCCCGGCGGGGCCACCCCAGTCTGCGTGTACACGAGGGATGAGGTGACGGGTGA
AGCTGCCCTGCGGGGCACGACGCTGCAGTCGCTGGGCCTGACCGGGGGCAGCGCCACCAT
CAGGTTTGTCATGAAGTGCTACGACCCCGTGGGCAAGACCCCAGGAAGCCTGGGCTCGTC
AGCGTCGGCTGGCCAGGCAGCCGCCAGCGCTCCACTTCCCTTGGAATCTGGGGAGCTCAG
CCGCGGCGACTTGAGCCGTCCGGAGGACGCGGACACCTCAGGGCCCTGCTGCGAGCACAC
TCAGGAGAAGCAGAGCACAAGGGCACCCGCAGCTGCCCCCTTTGTTCCTTTCTCGGGTGG
GGGACAGAGACTGGGGGGCCCTCCTGGGCCCACGAGGCCTCTGACATCATCTTCAGCTAA
GTTGCCGAAGTCCCTCTCCAGCCCTGGAGGCCCCTCCAAGCCAAAGAAGTCCAAGTCGGG
CCAGGATCCCCAGCAGGAGCAGGAGCAGGAGCGGGAGCGGGATCCCCAGCAGGAGCAGGA
GCGGGAGCGGCCCGTGGACCGGGAGCCCGTGGACCGGGAGCCGGTGGTGTGCCACCCCGA
CCTGGAGGAGCGGCTGCAGGCCTGGCCAGCGGAGCTGCCTGATGAGTTCTTTGAGCTGAC
GGTGGACGACGTGAGAAGACGCTTGGCCCAGCTCAAGAGTGAGCGGAAGCGCCTGGAAGA
AGCCCCCTTGGTGACCAAGGCCTTCAGGGAGGCGCAGATAAAGGAGAAGCTGGAGCGCTA
CCCAAAGGTGGCTCTGAGGGTCCTGTTCCCCGACCGCTACGTCCTACAGGGCTTCTTCCG
CCCCAGCGAGACAGTGGGGGACTTGCGAGACTTCGTGAGGAGCCACCTGGGGAACCCCGA
GCTGTCATTTTACCTGTTCATCACCCCTCCAAAAACAGTCCTGGACGACCACACGCAGAC
CCTCTTTCAGCCCCAGCTTGGTGACCGGGTGGCTCCATTCACCCTGGGTCCCTCGCTGAA
ACGGTGCCTGGGACCAGAGCAGAGAACACGCTTGCCAGTGGTAGGAGATGGAGGCGACGT
GGACTCTGGGAGGCTTCTTTTTTGGGGTCCATCCAGAGGCCGAGCCTCTCCAAGCACTGG
TCAGCCTCCATGCCACCCAGTCTGCCGACCCTCCTCTCCACCATCCCCTCGTCCGAGCAG
TGGCGATCCCTCCCGAGTCAAGGCTGGGCACAAGCACGTGGGGACAGGCCGGGCGAACCT
CTTCCCGGCCGCTCTGGTGCACTTGGGAGCCGAGGAGCCGGCAGGTGTCTACCTGGAGCC
TGGCCTGCTGGAGCATGCCATCTCCCCATCTGCGGCCGATGTGCTGGTGGCCAGGTACAT
GTCCAGGGCCGCCGGGTCCCCTTCCCCATTGCCAGCCCCTGACCCTGCACCTAAGTCTGA
GCCAGCTGCTGAGGAGGGGGCGCTGGTCCCCCCTGAGCCCATCCCAGGGACGGCCCAGCC
CGTGAAGAGGAGCCTGGGCAAGGTGCCCAAGTGGCTGAAGCTGCCGGCCAGCAAGAGGTG
AGAGCTGCCAGCCTGAGGTGCCCACTCCGCCAGCCACAGGACCACCTCCTCTGCCAGCAG
GAATAAAGACTTGTGCATCCCTCAAAAAAAAAAAAAAAAA

Protein Sequence

>79058 : length: 647
MAAPAGGGGSAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPCEYDLKFQRSVLD
LSLQWRFANLPNNAKLEMVPASRSREGPENMVRIALQLDDGSRLQDSFCSGQTLWELLSH
FPQIRECLQHPGGATPVCVYTRDEVTGEAALRGTTLQSLGLTGGSATIRFVMKCYDPVGK
TPGSLGSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAA
PFVPFSGGGQRLGGPPGPTRPLTSSSAKLPKSLSSPGGPSKPKKSKSGQDPQQEQEQERE
RDPQQEQERERPVDREPVDREPVVCHPDLEERLQAWPAELPDEFFELTVDDVRRRLAQLK
SERKRLEEAPLVTKAFREAQIKEKLERYPKVALRVLFPDRYVLQGFFRPSETVGDLRDFV
RSHLGNPELSFYLFITPPKTVLDDHTQTLFQPQLGDRVAPFTLGPSLKRCLGPEQRTRLP
VVGDGGDVDSGRLLFWGPSRGRASPSTGQPPCHPVCRPSSPPSPRPSSGDPSRVKAGHKH
VGTGRANLFPAALVHLGAEEPAGVYLEPGLLEHAISPSAADVLVARYMSRAAGSPSPLPA
PDPAPKSEPAAEEGALVPPEPIPGTAQPVKRSLGKVPKWLKLPASKR