ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

78986

Name

DUSP26

Synonym

DSP-4|DUSP24|LDP-4|MKP-8|MKP8|NATA1|NEAP|SKRP3;dual specificity phosphatase 26 (putative);DUSP26;dual specificity phosphatase 26 (putative)

Definition

MAP kinase phosphatase 8|Novel amplified gene in thyroid anaplastic cancer|dual specificity phosphatase SKRP3|dual specificity protein phosphatase 26|low-molecular-mass dual-specificity phosphatase 4|mitogen-activated protein kinase phosphatase 8|neuroend

Position

8p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Oxidative stress response;PANTHER;P00046

Disease

Thyroid cancer;FunDO

External Links

Links to cell senescence gene database

78986

Links to epithelial mesenchymal transition gene database

78986

Links to ovarian cancer gene database

78986

Links to endometrial cancer gene database

78986

Links to iHOP

78986

Sequence Information

Nucleotide Sequence

>78986 : length: 1852
AGTTAATTCTGTCTGGGAGGAGTGTGTGTGTTTAAGACAGTGCCTGGGATGACTTATAAT
GTAATCTTTAGGCAAAACGCTTTGTAATTGGTGCAGCTCTGAGAACACACGCATGCATTC
CAGGCGGTGCTGCTGGGGCTCGGCGGGGCCGTGTCTGGTCTGCAAGGCGCGCGGGCTCGT
GGGGGGTTGGCTGGGGAGCCCACGCTGCCTGGCGACTCGGGCCACCGAATGTGAGACCGA
GTCCCTTTATGTCACCAGCGCACACGCTGATTTGAACCCTGCTTCGACGTGTGTGTCATG
GCTTAAAAATAGCTGCTAATCTGTCAACCTGTCTTGGGCAGAAACAGCGGCGGCGACAGC
AGCAGGAGCGTCATGGCCGTGGCGCTGTCTGCGCCGGCGATCCGCCTTTCGGACTGAGGC
CCAGCGCAGCGCTTGCAAAGAGCAGCAGCTACCTGGCAACTGAACCCATCATCACCACAG
CCACTCCTGCAGCTGCCACGGTTTCTGCCACCTCTAAGATGTGCCCTGGTAACTGGCTTT
GGGCTTCTATGACTTTTATGGCCCGCTTCTCCCGGAGTAGCTCAAGGTCTCCTGTTCGAA
CTCGAGGGACCCTGGAGGAGATGCCAACCGTTCAACATCCTTTCCTCAATGTCTTCGAGT
TGGAGCGGCTCCTCTACACAGGCAAGACAGCCTGTAACCATGCCGACGAGGTCTGGCCAG
GCCTCTATCTCGGAGACCAGGACATGGCTAACAACCGCCGGGAGCTTCGCCGCCTGGGCA
TCACGCACGTCCTCAATGCCTCACACAGCCGGTGGCGAGGCACGCCCGAGGCCTATGAGG
GGCTGGGCATCCGCTACCTGGGTGTTGAGGCCCACGACTCGCCAGCCTTTGACATGAGCA
TCCACTTCCAGACGGCTGCCGACTTCATCCACCGGGCGCTGAGCCAGCCAGGAGGGAAGA
TCCTGGTGCATTGTGCTGTGGGCGTGAGCCGATCCGCCACCCTGGTACTGGCCTACCTCA
TGCTGTACCACCACCTTACCCTCGTGGAGGCCATCAAGAAAGTCAAAGACCACCGAGGCA
TCATCCCCAACCGGGGCTTCCTGAGGCAGCTCCTGGCCCTGGACCGCAGGCTGCGGCAGG
GTCTGGAAGCATGAGGGGAGGGGGAGAGAGGTCAGGCCAGGCCCGTGGGTAGGTCCCTGG
CTCCCAGCTGGAGATAGGAGGCCCAGGTGGCAGGTAGCAGGAGGCCCAGATCACCCATCC
TCCCCTGGGGTCAGGAGAGGCCGAGCCCCAGGCCACTGTCACTCTTTGTGGGAGGGGACG
GGGAGTGAGGTTGGGCAGTGTGGTGGATGGGCACCCAGGAAGGGTTGACCAGGGAAGGAG
GCAGCTAGGCTGTAGATGGAAGATGGTCCTGGGATTCGAACACCGCTGGGATCTGGCCAG
GGTGCTCCCTGGGATTCACAGTCCCTTCCCCTCTTTGTGCCCAAGTGTTTCCCTCTCTCC
CTCACCAAAACAAAAGGGCCATCTCTGCCCTGCACTTGTGCAGAAAGTCAGGGATACGGC
AAGCATGAATGCAATGGTGTAGAGTTGTGTGAAACCCCTAGCATAGAGACAGACAGCGAA
GAGATGGTGTGAAAAGCTTGCAGAACCAGACAGAGAACCCCACAGACTTTCCACTCCAAG
CACAGGAGGAGGTAGCTAGCGTGTGAGGGTTGGCACTAGGCCCACGGCTGCTGCTTGGGC
CAAAAACATACAGAGGTGCATGGCTGGCAGTCTTGAAATTGTCACTCGCTTACTGGATCC
AAGCGTCTCGAGGATAAATAAAGATCATGAAAAAGAAAAAAAAAAAAAAAAA

Protein Sequence

>78986 : length: 211
MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHD
SPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIK
KVKDHRGIIPNRGFLRQLLALDRRLRQGLEA