ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7852

Name

CXCR4

Synonym

CD184|D2S201E|FB22|HM89|HSY3RR|LAP-3|LAP3|LCR1|LESTR|NPY3R|NPYR|NPYRL|NPYY3R|WHIM|WHIMS;chemokine (C-X-C motif) receptor 4;CXCR4;chemokine (C-X-C motif) receptor 4

Definition

C-X-C chemokine receptor type 4|CD184 antigen|LPS-associated protein 3|SDF-1 receptor|fusin|leukocyte-derived seven transmembrane domain receptor|lipopolysaccharide-associated protein 3|neuropeptide Y receptor Y3|seven transmembrane helix receptor|seven-t

Position

2q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

pertussis toxin-insensitive ccr5 signaling in macrophage;PID BioCarta;100214

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

cxcr4 signaling pathway;PID BioCarta;100192

Pathway

Axon guidance mediated by Slit/Robo;PANTHER;P00008

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

beta-arrestins in gpcr desensitization;PID BioCarta;100231

Pathway

Intestinal immune network for IgA production;KEGG PATHWAY;hsa04672

Disease

WHIM syndrome;OMIM

Disease

Multiple sclerosis;NHGRI

Disease

Myelokathexis, isolated;OMIM

Disease

Chemokine receptor defect;KEGG DISEASE;H00097

Disease

multiple sclerosis;GAD

Disease

Telomere length;NHGRI

Disease

IMMUNE;GAD

Disease

Immune system diseases;KEGG DISEASE

Disease

Primary immunodeficiency;KEGG DISEASE

External Links

Links to cell senescence gene database

7852

Links to epithelial mesenchymal transition gene database

7852

Links to ovarian cancer gene database

7852

Links to endometrial cancer gene database

7852

Links to iHOP

7852

Sequence Information

Nucleotide Sequence

>7852 : length: 1912
TTTTTTTTCTTCCCTCTAGTGGGCGGGGCAGAGGAGTTAGCCAAGATGTGACTTTGAAAC
CCTCAGCGTCTCAGTGCCCTTTTGTTCTAAACAAAGAATTTTGTAATTGGTTCTACCAAA
GAAGGATATAATGAAGTCACTATGGGAAAAGATGGGGAGGAGAGTTGTAGGATTCTACAT
TAATTCTCTTGTGCCCTTAGCCCACTACTTCAGAATTTCCTGAAGAAAGCAAGCCTGAAT
TGGTTTTTTAAATTGCTTTAAAAATTTTTTTTAACTGGGTTAATGCTTGCTGAATTGGAA
GTGAATGTCCATTCCTTTGCCTCTTTTGCAGATATACACTTCAGATAACTACACCGAGGA
AATGGGCTCAGGGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAAGAAAATGCTAA
TTTCAATAAAATCTTCCTGCCCACCATCTACTCCATCATCTTCTTAACTGGCATTGTGGG
CAATGGATTGGTCATCCTGGTCATGGGTTACCAGAAGAAACTGAGAAGCATGACGGACAA
GTACAGGCTGCACCTGTCAGTGGCCGACCTCCTCTTTGTCATCACGCTTCCCTTCTGGGC
AGTTGATGCCGTGGCAAACTGGTACTTTGGGAACTTCCTATGCAAGGCAGTCCATGTCAT
CTACACAGTCAACCTCTACAGCAGTGTCCTCATCCTGGCCTTCATCAGTCTGGACCGCTA
CCTGGCCATCGTCCACGCCACCAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAAAGGT
GGTCTATGTTGGCGTCTGGATCCCTGCCCTCCTGCTGACTATTCCCGACTTCATCTTTGC
CAACGTCAGTGAGGCAGATGACAGATATATCTGTGACCGCTTCTACCCCAATGACTTGTG
GGTGGTTGTGTTCCAGTTTCAGCACATCATGGTTGGCCTTATCCTGCCTGGTATTGTCAT
CCTGTCCTGCTATTGCATTATCATCTCCAAGCTGTCACACTCCAAGGGCCACCAGAAGCG
CAAGGCCCTCAAGACCACAGTCATCCTCATCCTGGCTTTCTTCGCCTGTTGGCTGCCTTA
CTACATTGGGATCAGCATCGACTCCTTCATCCTCCTGGAAATCATCAAGCAAGGGTGTGA
GTTTGAGAACACTGTGCACAAGTGGATTTCCATCACCGAGGCCCTAGCTTTCTTCCACTG
TTGTCTGAACCCCATCCTCTATGCTTTCCTTGGAGCCAAATTTAAAACCTCTGCCCAGCA
CGCACTCACCTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGGAAAGCGAGG
TGGACATTCATCTGTTTCCACTGAGTCTGAGTCTTCAAGTTTTCACTCCAGCTAACACAG
ATGTAAAAGACTTTTTTTTATACGATAAATAACTTTTTTTTAAGTTACACATTTTTCAGA
TATAAAAGACTGACCAATATTGTACAGTTTTTATTGCTTGTTGGATTTTTGTCTTGTGTT
TCTTTAGTTTTTGTGAAGTTTAATTGACTTATTTATATAAATTTTTTTTGTTTCATATTG
ATGTGTGTCTAGGCAGGACCTGTGGCCAAGTTCTTAGTTGCTGTATGTCTCGTGGTAGGA
CTGTAGAAAAGGGAACTGAACATTCCAGAGCGTGTAGTGAATCACGTAAAGCTAGAAATG
ATCCCCAGCTGTTTATGCATAGATAATCTCTCCATTCCCGTGGAACGTTTTTCCTGTTCT
TAAGACGTGATTTTGCTGTAGAAGATGGCACTTATAACCAAAGCCCAAAGTGGTATAGAA
ATGCTGGTTTTTCAGTTTTCAGGAGTGGGTTGATTTCAGCACCTACAGTGTACAGTCTTG
TATTAAGTTGTTAATAAAAGTACATGTTAAACTTAAAAAAAAAAAAAAAAAA

Protein Sequence

>7852 : length: 356
MSIPLPLLQIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGN
GLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIY
TVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFAN
VSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRK
ALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCC
LNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS