ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7849

Name

PAX8

Synonym

paired box 8;PAX8;paired box 8

Definition

paired box protein Pax-8|paired domain gene 8

Position

2q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

hypothyroidism, congenital;GAD

Disease

Cancers;KEGG DISEASE

Disease

Hypothyroidism, congenital, due to thyroid dysgenesis or hypoplasia;OMIM

Disease

METABOLIC;GAD

Disease

Cancers of endocrine organs;KEGG DISEASE

External Links

Links to cell senescence gene database

7849

Links to epithelial mesenchymal transition gene database

7849

Links to ovarian cancer gene database

7849

Links to endometrial cancer gene database

7849

Links to iHOP

7849

Sequence Information

Nucleotide Sequence

>7849 : length: 4143
ATAAAACCGGTCGGTGATGCCGGGTGGATGGGAACAAACTTCAGAAGGAGGAGAGACACC
GGGCCCAGGGCACCCTCGCGGGCGGACCCAAGCAGTGAGGGCCTGCAGCCGGCCGGCCAG
GGCAGCGGCAGGCGCGGCCCGGACCTACGGGAGGAAGCCCCGAGCCCTCGGCGGGCTGCG
AGCGACTCCCCGGCGATGCCTCACAACTCCATCAGATCTGGCCATGGAGGGCTGAACCAG
CTGGGAGGGGCCTTTGTGAATGGCAGACCTCTGCCGGAAGTGGTCCGCCAGCGCATCGTA
GACCTGGCCCACCAGGGTGTAAGGCCCTGCGACATCTCTCGCCAGCTCCGCGTCAGCCAT
GGCTGCGTCAGCAAGATCCTTGGCAGTAGGTACTACGAGACTGGCAGCATCCGGCCTGGA
GTGATAGGGGGCTCCAAGCCCAAGGTGGCCACCCCCAAGGTGGTGGAGAAGATTGGGGAC
TACAAACGCCAGAACCCTACCATGTTTGCCTGGGAGATCCGAGACCGGCTCCTGGCTGAG
GGCGTCTGTGACAATGACACTGTGCCCAGTGTCAGCTCCATTAATAGAATCATCCGGACC
AAAGTGCAGCAACCATTCAACCTCCCTATGGACAGCTGCGTGGCCACCAAGTCCCTGAGT
CCCGGACACACGCTGATCCCCAGCTCAGCTGTAACTCCCCCGGAGTCACCCCAGTCGGAT
TCCCTGGGCTCCACCTACTCCATCAATGGGCTCCTGGGCATCGCTCAGCCTGGCAGCGAC
AAGAGGAAAATGGATGACAGTGATCAGGATAGCTGCCGACTAAGCATTGACTCACAGAGC
AGCAGCAGCGGACCCCGAAAGCACCTTCGCACGGATGCCTTCAGCCAGCACCACCTCGAG
CCGCTCGAGTGCCCATTTGAGCGGCAGCACTACCCAGAGGCCTATGCCTCCCCCAGCCAC
ACCAAAGGCGAGCAGGGCCTCTACCCGCTGCCCTTGCTCAACAGCACCCTGGACGACGGG
AAGGCCACCCTGACCCCTTCCAACACGCCACTGGGGCGCAACCTCTCGACTCACCAGACC
TACCCCGTGGTGGCAGATCCTCACTCACCCTTCGCCATAAAGCAGGAAACCCCCGAGGTG
TCCAGTTCTAGCTCCACCCCTTCCTCTTTATCTAGCTCCGCCTTTTTGGATCTGCAGCAA
GTCGGCTCCGGGGTCCCGCCCTTCAATGCCTTTCCCCATGCTGCCTCCGTGTACGGGCAG
TTCACGGGCCAGGCCCTCCTCTCAGGGCGAGAGATGGTGGGGCCCACGCTGCCCGGATAC
CCACCCCACATCCCCACCAGCGGACAGGGCAGCTATGCCTCCTCTGCCATCGCAGGCATG
GTGGCAGGTAAGGAGAGGGCCGGCAGGAAGGGGAGCACTGCAAAGAGGAAGTATTGGAGC
AAGGAAGTGAATACTCTGGCAATGCCTATGGCCACACCCCCTACTCCTCCTACAGCGAGG
CCTGGCGCTTCCCCAACTCCAGCTTGCTGAGTTCCCCATATTATTACAGTTCCACATCAA
GGCCGAGTGCACCGCCCACCACTGCCACGGCCTTTGACCATCTGTAGTTGCCATGGGGAC
AGTGGGAGCGACTGAGCAACAGGAGGACTCAGCCTGGGACAGGCCCCAGAGAGTCACACA
AAGGAATCTTTATTTATTACATGAAAAATAACCACAAGTCCAGCATTGCGGCACACTCCC
TGTGTGGTTAATTTAATGAACCATGAAAGACAGGATGACCTTGGACAAGGCCAAACTGTC
CTCCAAGACTCCTTAATGAGGGGCAGGAGTCCCAGGGAAAGAGAACCATGCCATGCTGAA
AAAGACAAAATTGAAGAAGAAATGTAGCCCCCAGCCGGTACCCACCAAAGGAGAGAAGAA
GCAATAGCCGAGGAACTTGGGGGGATGGCGAATGGTTCCTGCCCGGGCCCAAGGGGTGCA
CAGGGCACCTCCATGGCTCCATTATTAACACAACTCTAGCAATTATGGACCATAAGCACT
TCCCTCCAGCCCACAAGTCACAGCCTGGTGCCGAGGCTCTCCTCACCAGCCACCCAGGGA
GTCACCTCCCTCAGCCTCCCGCCTGCCCCACACGGAGGCTCTGGCTGTCCTCTTTCTCCA
CTCCATTTGCTTGGCTCTTTCTACACCTCCCTCTTGGGCATGGGCTGAGGGCTGGAGCGA
GTCCCTCAGAAATTCCACCAGGCTGTCAGCTGACCTCTTTTGCCTGCTGCTGTGAAGGTA
TAGCACCACCCCAGGTCCTCCTGCAGTGCGGCATCCCCTTGGCAGCTGCCGTCAGCCAGG
CCAGCCCCAGGGAGCTTAAAACAGACATTCCACAGGGCCTGGGCCCCTGGGAGGTGAGGT
GTGGTGTGCGGCTTCACCCAGGGCAGAACAAGGCAGAATCGCAGGAAACCCGCTTCCCCT
TCCTGACAGCTCCTGCCAAGCCAAATGTGCTTCCTGCAGCTCACGCCCACCAGCTACTGA
AGGGACCCAAGGCACCCCCTGAAGCCAGCGATAGAGGGTCCCTCTCTGCTCCCCAGCAGC
TCCTGCCCCCAAGGCCTGACTGTATATACTGTAAATGAAACTTTGTTTGGGTCAAGCTTC
CTTCTTTCTAACCCCCAGACTTTGGCCTCTGAGTGAAATGTCTCTCTTTGCCCTGTGGGG
CTTCTCTCCTTGATGCTTCTTTCTTTTTTTAAAGACAACCTGCCATTACCACATGACTCA
ATAAACCATTGCTCTTCATCTCAGGCTTTGGGGTTGGCTGGGGAAGGAGGCATCCCGGGG
CTGGGCTTTCTCCCAAGAACATCAGAGCTGAGTAGCCGACAAACTCACTTTGGGGCCGTG
GGCTGGAAGGGACCATCTGATGCCCCAGAGCTCTGGCTTGGCCTTCTCCCTCTGCCTTTA
ATTCACGTTGAACGCTGGGTACCTCACTCATCCCAAGTTCTTCAACACTGAGCAAATGCA
AGGATAGCACAGTACTGAGCCAACCATAGACTCCCCACAAGGAGTTGCTGTTGTTATTAA
CAGGAAGCCAGAGAATCAGCAGGGTGGGTTAGTGAGGGATCCGGGAATAGCTGTGACTGG
AGCCTGCATAAACAGCTCTGAAGGGAGAGAGAAGACTGGGCTCTCTTGTGTGCCAGGCAC
AGTATGGAAGGCTTCATATAAGTTAAGCTGAAATTAGCCCTGTTTTACATACAGCTTCAT
TTTACATATGAGGAAACTGAGGCTTTGAAAAAAATGAGATGTCTTGTCCAAGATGAAAAG
TAGTAGATTCAACCAAGTCCTCTTACTCTAAGCCCAACGCTTTTACCCAAAACCCCAGAG
TCCTCATCAGGGATGCCAAATGGTTCTAGACCCAGTGGAGGTTCTGGAGCTGCCACTGGG
GATTTAATTTCTTTTGATTTGCTAAAGATTTGACCTGACTGAATGGAGAGGTAGAGTGTA
GTGTGGCCAGGACAAGGTGAGGGAGGCTGTAGAGACTTAGCACTTTAGGCCAACCACCTC
CAGGAAATCTGGGAAATGCAATGTGACAGCTCGGGCTCTGCACTCCAGGGGGCTGTCTGG
TGTCCACATGGACCTTCTCCATGTGGGACACAGCTGGAACAAGGGGGCAGGGGCCTGCAG
CTGGGATGCCCAGGTGAATATGGGCAGCTGGACAAACAACACTGGGATTGAGTCAGATAG
AAGGGGCCCAAGGACTCCAGGGCTGGGAGGACAGAGGCTGGGAGAGAGGGCTCTTACCTC
CTTAGGCCTCCCAAAGAGCGGTTAGGGATGCTGCCATGGATGGCATGGCAGGGGGAACCC
TCCTGGAAGAAAATCCATCTCTTCTGAAGGGATCTGAGATGCGGCTGGTTTTTCAATGGC
AGAACTTCCCTCTGCAGCGCGACTCCGAATCCATGACATCTGAGAGTCTTCCTGACCACA
AACCTCTGGGATCCCGAGGGCTCCCTACCCAAGAATCACTTTGAGCACAGCATCCCAAGG
AGCCCATAGAGCGATCCCTTGCATTCACAGCCACAGCCCCTCTGGGGACACTCTGTACCC
CCGGCAGACCCTTTCCAACTCACAACCAATAAAGGGGCTTGGGCTGTGCTTTGACTAAGG
TGA

Protein Sequence

>7849 : length: 507
MGTNFRRRRDTGPRAPSRADPSSEGLQPAGQGSGRRGPDLREEAPSPRRAASDSPAMPHN
SIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGS
RYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVP
SVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSIN
GLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQ
HYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHS
PFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSG
REMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSS
LLSSPYYYSSTSRPSAPPTTATAFDHL