ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7813

Name

EVI5

Synonym

EVI-5|NB4S;ecotropic viral integration site 5;EVI5;ecotropic viral integration site 5

Definition

dJ846D11.1 (ecotropic viral integration site 5)|ecotropic viral integration site 5 protein homolog|neuroblastoma stage 4S gene protein

Position

1p22.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Aurora B signaling;PID Curated;200010

Disease

multiple sclerosis;GAD

Disease

IMMUNE;GAD

Disease

Multiple sclerosis;NHGRI

External Links

Links to cell senescence gene database

7813

Links to epithelial mesenchymal transition gene database

7813

Links to ovarian cancer gene database

7813

Links to endometrial cancer gene database

7813

Links to iHOP

7813

Sequence Information

Nucleotide Sequence

>7813 : length: 8024
TGGGGAAGAAACTCGTCGGCGGGTCTAACTGTGGCGTCCCAGGGCGGTGGAGGGACGGAG
CAGCTTCGGGGGCACGTCCTCGTAAATCCCGTGGAGGACACTGACCCTGCACCCCACCCT
CGAGGCCAGAAGTCGGTTCCCTTTGGGGACCTGAGGGGCGAGAGCACTCGCCCCCCTGAC
TTGCAAAGTTGGCGTCTTTACTTGGCCTCCGGGATTCTGCGCATGGCGTGTCTCCAGGCT
GCTGATGGGCAAGACAGATGTGCCAGGTCCAGAATGAACTTGAGAAGAGTTTGTAGCCAT
TCCTGAATCACCTTATGACTAGTGGGGCAAGCCTCAAATTAACCTCAGGATTTCCGGTGG
CGACAGACAAAGTTGCAGAAAAGCTGAGCTCTACTCTCTCATGGGTGAAGAACACAGTAT
CGCATACAGTCAGTCAGATGGCCAGTCAGGTGGCAAGTCCATCTACTTCATTACATACCA
CATCCTCATCTACCACACTATCAACACCAGCCCTTTCACCATCTTCCCCATCACAGTTGA
GTCCAGACGACTTAGAACTCCTGGCTAAACTGGAAGAACAGAATAGATTGTTAGAAACGG
ATAGTAAGTCTTTAAGATCTGTAAATGGGTCAAGAAGAAACAGTGGCTCTTCTCTTGTGT
CGAGTTCATCAGCCTCTAGCAACCTCAGTCACCTTGAAGAAGATTCTTGGATTCTTTGGG
GAAGAATTGTTAATGAATGGGAAGATGTACGCAAAAAGAAGGAAAAGCAAGTTAAGCCCT
TTGAATGTTGGGTACTGTACCATCATTCACAGCTCTGCAGGTTTCAAGTCCATTACCTTA
AGAGGTCACACACTGAGGAACTTGTTCATAAAGGGATACCCCATCACTTTAGAGCAATAG
TTTGGCAACTTTTATGCAGTGCACAAAGTATGCCAATTAAGGATCAGTATTCAGAACTCC
TGAAAATGACCTCGCCTTGTGAAAAATTGATCCGAAGGGACATTGCTAGAACTTACCCTG
AACACAACTTTTTTAAGGAAAAAGATAGCCTTGGACAGGAGGTTTTATTTAATGTAATGA
AGGCTTACTCTTTAGTAGATCGTGAGGTTGGTTACTGTCAAGGAAGTGCTTTTATAGTTG
GATTGTTGCTTATGCAGATGCCAGAAGAAGAAGCTTTCTGTGTATTTGTTAAATTAATGC
AAGATTATAGACTTCGTGAACTTTTTAAACCAAGTATGGCAGAATTGGGCCTTTGTATGT
ACCAGTTTGAATGTATGATACAGGAGCATCTTCCAGAGCTCTTTGTACATTTTCAATCTC
AGAGTTTTCATACCTCAATGTATGCATCATCCTGGTTTCTGACTATCTTTCTTACAACTT
TTCCACTACCAATTGCAACAAGGATATTTGATATCTTTATGTCTGAGGGTTTAGAAATAG
TGTTTCGTGTAGGATTAGCACTTCTTCAGATGAATCAGGCAGAACTGATGCAACTTGACA
TGGAAGGGATGTTACAGCACTTTCAAAAGGTCATTCCACATCAGTTTGATGGTGTCCCAG
ACAAGCTAATCCAAGCAGCTTACCAAGTCAAATACAATTCAAAAAAAATGAAAAAGCTTG
AAAAGGAATACACTACAATAAAAACGAAAGAAATGGAAGAGCAAGTTGAAATTAAAAGGT
TACGCACAGAAAATAGACTTTTAAAACAGCGCATCGAGACATTAGAAAAAGAAAGTGCTT
CCTTGGCAGATAGATTGATACAGGGACAAGTGACAAGAGCCCAGGAGGCTGAGGAAAACT
ACCTCATAAAACGGGAGTTGGCCACCATCAAACAGCAGAGTGATGAGGCCAGTGCTAAGC
TGGAGCAAGCTGAAAATACCATCAGGAAGCTCCAGCACCAACAACAATGGCATAAATGCA
GTTCCAACTACAACGAAGATTTTGTGCTACAGCTAGAGAAGGAATTGGTCCAAGCCCGAC
TGAGTGAAGCTGAGTCTCAGTGTGCATTAAAAGAGATGCAGGATAAAGTCTTGGATATAG
AGAAGAGGAATAACTCCCTTCCTGATGAGAATAATATTGCAAGGCTTCAGGAAGAACTCA
TTGCTGTGAAACTTAGAGAAGCAGAAGCCATTATGGGTTTGAAAGAACTTAGACAGCAAG
TCAAGGATTTAGAGGAACACTGGCAGCGCCACTTAGCTCGTACTACTGGGAGATGGAAAG
ACCCACCCAAGAAAAATGCTATGAATGAGTTACAAGATGAACTGATGACCATTCGACTTA
GAGAAGCTGAAACACAAGCAGAAATAAGAGAAATAAAACAAAGGATGATGGAAATGGAAA
CACAGAACCAGATCAATAGTAACCATCTTCGAAGAGCAGAACAAGAGGTGATTAGCCTAC
AGGAGAAAGTGCAGTATCTTTCTGCACAGAACAAAGGACTCCTTACTCAATTAAGTGAAG
CAAAGCGTAAACAAGCAGAGATTGAATGCAAGAATAAGGAAGAAGTGATGGCTGTGAGGC
TTCGGGAAGCAGATAGCATAGCTGCTGTGGCTGAACTACGACAACACATTGCTGAGCTTG
AAATCCAGAAAGAAGAAGGAAAGCTTCAAGGACAGCTTAACAAGTCTGATTCTAACCAGT
ATATTGGGGAACTGAAAGATCAGATAGCAGAGCTGAATCATGAGGGGGAGTTGGGGAGAG
AAGGCAGAAATGTTATACCGGACTGGCACTCCCCCCATGCAGAAGGAAACCTCATGAGTG
GGAAGCAGCATTCCTCTCCCACACTCAGGTGCCTAAAAGGCCAGAGGGGCTTCTCAGGCC
AACCTCCTTTTGATGGAATCCACATTGTCAACCATTTAATAGGAGATGATGAATCATTCC
ATTCCTCCGATGAAGATTTTATAGATAATTCCTTACAGGAAACTGGTGTTGGTTTTCCTT
TGCACGGAAAATCTGGTTCGATGTCTTTGGACCCCGCAGTGGCAGATGGTAGTGAGAGCG
AAACAGAAGACAGTGTGCTGGAGACCAGAGAGAGCAACCAAGTGGTTCAAAAGGAGCGGC
CCCCGAGAAGAAGAGAGTCGTATTCAACCACTGTCTGACCATCACTGTGACCTAGACTAT
GGATTTATTTAAGGGATCAGTTATCATATGATTAGGGCTTTTTGGAAATAATTTGTTTCA
TATGTATATATATATATATATATATATATTTTACAGTCTTATCTGCCTTTTTATCTTTGC
CAAATCTTTACCACTGATTTACCATTGCCATAAAGTAGACTGGTATATGGTTAATGTGTA
AAACAAGGTTCTAACAGTATTACTGAATATTAATGTTTCTTGTTTAGAAAATGCAACTAT
ATCTATATGTGGGAACCATTCTGAAGTTCAAAACTATGGAAAATTGAATTTTCTTCAGAC
AAAACTGCTCTTGTGCAATATTTTATGCTCAGTGAGCAAATTGTGTATTTATGTTTATCA
ATTTGTTCTCAAGGTGGCTGTCTACAGACATTTGACCAAGACATACATCTGATTTACCTT
GTGTTTTTTTTTTTATTGTTGTTTTTTTTTTTAAGACAGAGATTCAGTCTGTCACCCAGG
CTGGAGTGCTGTGGTGTGATCTTAGCTCACTGCAACCTCCGCCTCCCAGGTTCAAGCAAT
TTTCCTGCCTCAGCCTCCCGAGTACCTGGGACTATATGTGCGCACCACCACGCCTGGCTA
ATTTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGCTGGGCTGGTCTCGAACT
CCTAACCTCAAGTGATCCACCCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGTGTGAG
CCACTGCACCCAGCCTACCTTGTCTGTTTGTGTCTGGGAGGTTTTTTTTTTCTATTTTTA
TTTTTTCATGAAAATTATTGGTGGGCCACTGAAAGTCCCCACACACAAAGCCTTTATTCT
ATATAATTTTATAAACACAAATTCATGATTATCTGTTTTGAGAGTTTTAAGTTTTGTTTT
AATGTTTAACTTTTATGTGCATATGATGCTTCCATGTGTTGGTTACTAGAGTAGTAGGTT
AACTACAGACATACTGTTTTGTTTGTACATATTTATAAATCTGTACCACCTAACATTGAA
CATCATTTTATATGAAGAACATACATGTTGCAAAATGACTGCTTTCAGCATCTAACAGGA
CTTCTGTAAATAATAGGTTAAAAGTTAAAAATAAAACACTAATGTTTTAAGAGCTTTAGT
ATTTTGCTTAGCATTCAATACTAGCAGATTCATAACTGATGCCTGTTCAAAAACACTGTT
GGTGGAATCTTTTATTTCATGTGTATGTAACTACTAAATTTTTCATGACTGAAGAGGTTA
TAGCACATATTAGTTAGTGCTAATATTCTACTGAATATAATTTAAGCAATGGGCTAAGGT
CCAAGAAACATAGCAATTATATCTACAAATAATCTATTAACATGATCTTCAGAATCTCTA
GTTTTTGTTCTATAGATAAAGCCATAAGAATCCTTTCCTACCAGTTTTTCCTATATCATT
TAGATATTATTTCCTAGAAAACAGGATGCCTGTCACTGATAAGTTAGAGAAAACACCCAA
ATTATACTTGCACTATGGAAAGACGACATGAATATGTTGACTGGGTACTTTCTACTCTCA
TTTTTGTTAGCCTATGAAAAAAAAAACATTTTGTTAACCTATGGAAAAAGCCTTGGAAGA
GAAAAGTAGAATTCAGTATGTATGGAGGCACAGTTTTGCACAGTATGTTGCATGCGGCAA
AAAAAAAAATATGAAATAGAGTAGAAGAGATAAAAGTAGTTTTCTGTCAAAAACTAGGAG
TTAAGCCTTCAGGTACGTTGTGGACTAGGCTTTCCAGCAAGGTTTTTGTAGCTATTTGCT
TGCCTGAGAAATGAAATTGAAAACATACCCCTGCGTGTCTGTCCTTAACACCAGGCTAAA
TTCTGGTGGTTAAATAACTTATCTGTGGTTACAAGCTAGTAAGTAGCAGAGCCAAGATTT
TTTTTAATATAGAGACAGGTGTCTCACTGTGTTGTCCAGGCTGGTCTTGAACTCCTGGCC
TCAAGTGGTCCTCCTGCCTCAGCCTCCCAAAGTGTGGGGATTACAGGTGCGAGCTACTGC
TCCCAGCAAGAGCCAAGATTTTAACCTAGATCTCCCTAACACCAAAGCTTTTGAAAGGGT
TCAGCTGAAGAATTTCTCAATTCTCTGTTTTGTTTTGTTTTTATTTTTGTTTTTTGAGAT
GAAGTCTCACTGCACTCAGGCTGGAGTGCAGTGGTACGATCTTGGCTCACTGCAACCTCC
ACCTCCCGGGTTCAAGCGATTCTCCTGCCTCAGCTCCCAAGTAGCTGGGACTACAGGTGC
ACGCCACCACAACTGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCGCTATGTTGG
CCAGGCTGATCTCAAACTTCTGACCTCAGGTGATCCACCCACTTTGACCTCCCAAAGTGC
TGGGATTACTAGACGTAAGCCACCACACCTGGCAATTCCCTGCTTTTTTGACAACATAAT
TTAAATGAATTTGATTTAAATGTTTCCTGAATATATATACAGATAGATAGATGAGTATCA
ACACTTACAAGCTCTACACAGTCTGTGAGTGTAGATACTACTTACTCGTAGGATTGTCTT
GTGCTTTGGGGATTTTTGTTCGGAGTTCTATACTATCAGCCCAGAAAGCTATCAATGTCC
AAGTGAAGTGAGATGATGCATGGCCACATTATTGCTTTGACCCTCACATCAAGAAATCTG
AATGATCTGGACCAGGGGTCAGCAAAGTGCAGCCTACAAGCTATTGCAGTCAGCTGCCAG
TTTTTACTTTTTTAAATAGTTGGGAAAAAAATTCCAAAGACTGATATTTTGTGTCACATG
AAAATTATATGAAATTCAAATTGCAGTGTCCATAAGTAAAGTTTTATTGGGGCACACCCA
TGCTCACCCTTTTAAATATTGTGTATGGCCGCTTTGTGCTACAGTAGCAGAGTTGAGTCA
TTGCAAGGGAGACCATATGGCCCAGGTAGCCTAAAATATTTATCTGATCCTTTACAGAAA
AAGTTTGCTAACCCTTGATAACAGATACTCTAAAATGCAGGTTTTTCTTCTTCAATTTAG
CTCAGTGGTAGGTCAAATTGTTTGCTTTTGCTATTAAGCTTATGATTTGGAAACGTAAAA
TTTCATGGTGGATATTATAATCAGAACTATTCAAAAGGGAAAACATGCCAGCCATTTTAT
ATGATGAAGTCTCTTATTCCATAGAAAACTGTAGAAAGATATCTGTATCTTTGGAGAAGG
AGAAAGAAAGGAAAGAACTCCAGAATCCCATCACTGTTCTTTAAAGCATGCATCACAGAC
CTTTAAGAGTATGCTTTATTGAGTAAAGGTTATAGTTTGACTTTAAGATAAGAAATTTTC
TAGAATCATGTTTGAATTCTAAACGTTGATATTCTTAAGTACCATTTCTGATTAGGAATT
AGGTGTTAAAAGAATCATGGTAAGGAAACCTTAATCCGTTGAAACTCTTGTAATTTGGAC
AACAAAAAACTAGAAATAACACTCTTTTCTTTGAAGATCTGATTCAAATACACCTTAGAA
GAGTTTAAAATCTCCCAGGCCTTTAGGATGCAATAGGATATTATGCCTTGGTTTGACTCC
TTTTCATTCAAATTAATGTAAGTATGTTGTTCAAGACTTTGAAGCATTGAACAATGTTCT
CGATGAATTTTATTTAATTACTGACATTTTGTGATATTTGAATGTTATTAAGTTAAACAC
TTAGAGTTGAGTATATTCAGGGGAGAAAAGTGAATGAAATGACTCATAATAAGAAAGCTT
GCTCCCTTGGGACAGTTACCTTCCTGGTGTCATTGCCATCCTGGGTTGACAAGCTGAGAG
TAGAGGATACAAGTGATGTGAATAAAATGGAAATTGCATTGAGTTAATGAAACAGACACT
TTTAGATCAAGAAAACACTTCAACAGCCTTTTTAGAAATTGGCACACTCCTATAGTCCCA
CCTACTCAAGAGGCTGAGGCAGGAGGATCACTAGAGTACAGGAGTTTGGGGCTGTAGTGT
GTAATGATCACACCTGTGAAAGAATAACCACTGCACTCCAACCTGGGCAACATGGCAAGA
CCCTGTCTCTTTAAAAAAAAAAAAAATCCTGGGAAAAGAAGTCAAAGATGTAATTTTACA
CAATTTCTGCCCCCACCGTCTTTTTTGTTTGTTTGTTTGTTTGTTTGTTTTTTGGCTAGA
TACTAGGTATTCAGTGTTTGCTGAGATGACAGGTTTCTACTAATCAGCCAGTTATTTGGG
AAGGAGAAAAACTTTTTCTCAATTCTGAACATGATGCAGCTTGTTAACTCTCCAGATAGT
GCCTTTGATTGAAAATAAGGTCTACACCTTTTTAAGTATATTATTTCTGACATCGTAAGA
AATAATTTAGTTCCTTATTCTCATTTATCTTTTATATAATGTACTGTAATATTCAGGTTT
AAAGTAAAATAAGTATATGAATTATATTTTGGTAAAACTGTTTCATGACCAGCTTGATTA
ATGTATATTAACATACCAGACATTGACAGCGAACATTTCATGAAATCAGTTATTTACTTA
CCAAAACAATGAGTTTTAGCTTGAAAGTTACTGCTGCTCTATTATTAACAAAACTAAGTT
TTAAAAATTAATTTTAATTCTACTGAAGTTTAATTTCTGGTTAAAGGTATAGTGGATGCT
ATTTATGATCCAAGTTTTTACATCACATCCATTGATCTGCCTATCCCTTCTTTTTACTCC
AAAGAGGAGATGATAGAATAATACATTCAGTATACTACCAAGAAGCAAAGTTATAATGTG
TTTCATTTTGCTATTGGAATTTTTTATTGTAACATTGTATGATAACCTGAAATGTTTACT
TGTGCCTTTTCTTTAAACAATTAAAGTTTTCCATTTTATAAGAA

Protein Sequence

>7813 : length: 927
MTSGASLKLTSGFPVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSST
TLSTPALSPSSPSQLSPDDLELLAKLEEQNRLLETDSKSLRSVNGSRRNSGSSLVSSSSA
SSNLSHLEEDSWILWGRIVNEWEDVRKKKEKQVKPFECWVLYHHSQLCRFQVHYLKRSHT
EELVHKGIPHHFRAIVWQLLCSAQSMPIKDQYSELLKMTSPCEKLIRRDIARTYPEHNFF
KEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRL
RELFKPSMAELGLCMYQFECMIQEHLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPI
ATRIFDIFMSEGLEIVFRVGLALLQMNQAELMQLDMEGMLQHFQKVIPHQFDGVPDKLIQ
AAYQVKYNSKKMKKLEKEYTTIKTKEMEEQVEIKRLRTENRLLKQRIETLEKESASLADR
LIQGQVTRAQEAEENYLIKRELATIKQQSDEASAKLEQAENTIRKLQHQQQWHKCSSNYN
EDFVLQLEKELVQARLSEAESQCALKEMQDKVLDIEKRNNSLPDENNIARLQEELIAVKL
REAEAIMGLKELRQQVKDLEEHWQRHLARTTGRWKDPPKKNAMNELQDELMTIRLREAET
QAEIREIKQRMMEMETQNQINSNHLRRAEQEVISLQEKVQYLSAQNKGLLTQLSEAKRKQ
AEIECKNKEEVMAVRLREADSIAAVAELRQHIAELEIQKEEGKLQGQLNKSDSNQYIGEL
KDQIAELNHEGELGREGRNVIPDWHSPHAEGNLMSGKQHSSPTLRCLKGQRGFSGQPPFD
GIHIVNHLIGDDESFHSSDEDFIDNSLQETGVGFPLHGKSGSMSLDPAVADGSESETEDS
VLETRESNQVVQKERPPRRRESYSTTV