ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7803

Name

PTP4A1

Synonym

HH72|PRL-1|PRL1|PTP(CAAX1)|PTPCAAX1;protein tyrosine phosphatase type IVA, member 1;PTP4A1;protein tyrosine phosphatase type IVA, member 1

Definition

protein tyrosine phosphatase type IVA 1|protein tyrosine phosphatase type IVA protein 1|protein-tyrosine phosphatase 4a1|protein-tyrosine phosphatase of regenerating liver 1

Position

6q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by PRL;PID Curated;200006

External Links

Links to cell senescence gene database

7803

Links to epithelial mesenchymal transition gene database

7803

Links to ovarian cancer gene database

7803

Links to endometrial cancer gene database

7803

Links to iHOP

7803

Sequence Information

Nucleotide Sequence

>7803 : length: 5093
AAAGATGACCGTGGTTAAGGCAGTAGAAAGCAGGCTCGACACTGAGACGCGGTTCCAGCC
CTAGAAGGATTGCATTTTACGATTCAGGCAAACTTCGAGTCTCCTCATGTGACATGTGTG
CACTCCTGGACCGTTTTAATTATGAGAAACGTGGTTTGCAGCATGATTCCTTCCAGTCGA
TAAATCGGAATCTCTCTCGCTCCCACCCCTTCTTAACTTCAGGCTTCCTGCATCCCGGAG
CACTCCCGGCAGCCCCTTCCCTCCCCCGCCCCGGGGATGCTCCGACTCGGCGCTTAGCCA
TTCATCAACCGGTTCACACCGGCGGCGGCCGCCGCGGAGTGACGTCCGGAGGGGGCGGGC
CTCCGCCCCCGCCTGTCGGCTCCTGGCCCGCGGTTCCAGGCCGCGATTGGTGGCTGGAGG
GTTGCACGTCGCGCCGGCTATAAAGGGGAGGGCTTGTGACGCAAGGGCGCCTCGGCGCGT
GTATTGGCTCCTTCGGCTGCGGGCCGGCTCGGCTACGCGCTCTGCTCCGAGCCGCTCACT
GCATGGTAGAGTCTGGTGCCCCCGCCGCCGCCTGCATCGCCGCCACCGCCGCTCCGCCAC
GACCACCGCCGCCTCCTGCCCTGCAGCCACCGCCACCGCCTGTGTCGCCGCCGCCTCGGG
ACCGGCTGTATGATTAGGCCACAATCTTCAATGAGTAAACATATTCCTCAATTCTGTGGT
GTTCTTGGTCACACATTTATGGAGTTTCTGAAGGGCAGTGGAGATTACTGCCAGGCACAG
CACGACCTCTATGCAGACAAGTGAACTGTAGAAACTGATTACTGCTCCACCAAGAAGCCC
CCATAAGAGTGGTTATCCTGGACACAGAAGTGTTGAATTGAAATCCACAGAGCATTTTAC
AAGAGTTCTGACCTGGATGGGGTAAACCTCAGTGCACTTCTTTTCTGTTGGCCTCAGTAT
TACTGGATTGAAGAATTGCTGCTTCTTGTTAGGAGGTTCATTTCACTTATCATTACTTAC
AACTTCATACTCAAAGCACTGAGAATTTCAAGTGGAGTATATTGAAGTAGACTTCAGTTT
CTTTGCATCATTTCTGTATTCAATTTTTTTAATTATTTCATAACCCTATTGAGTGTTTTT
TAACTAAATTAACATGGCTCGAATGAACCGCCCAGCTCCTGTGGAAGTCACATACAAGAA
CATGAGATTTCTTATTACACACAATCCAACCAATGCGACCTTAAACAAATTTATAGAGGA
ACTTAAGAAGTATGGAGTTACCACAATAGTAAGAGTATGTGAAGCAACTTATGACACTAC
TCTTGTGGAGAAAGAAGGTATCCATGTTCTTGATTGGCCTTTTGATGATGGTGCACCACC
ATCCAACCAGATTGTTGATGACTGGTTAAGTCTTGTGAAAATTAAGTTTCGTGAAGAACC
TGGTTGTTGTATTGCTGTTCATTGCGTTGCAGGCCTTGGGAGAGCTCCAGTACTTGTTGC
CCTAGCATTAATTGAAGGTGGAATGAAATACGAAGATGCAGTACAATTCATAAGACAAAA
GCGGCGTGGAGCTTTTAACAGCAAGCAACTTCTGTATTTGGAGAAGTATCGTCCTAAAAT
GCGGCTGCGTTTCAAAGATTCCAACGGTCATAGAAACAACTGTTGCATTCAATAAAATTG
GGGTGCCTAATGCTACTGGAAGTGGAACTTGAGATAGGGCCTAATTTGTTATACATATTA
GCCAACATGTTGGCTTAGTAAGTCTAATGAAGCTTCCATAGGAGTATTGAAAGGCAGTTT
TACCAGGCCTCAAGCTAGACAGATTTGGCAACCTCTGTATTTGGGTTACAGTCAACCTAT
TTGGATACTTGGCAAAAGATTCTTGCTGTCAGCATATAAAATGTGCTTGTCATTTGTATC
AATTGACCTTTCCCCAAATCATGCAGTATTGAGTTATGACTTGTTAAATCTATTCCCATG
CCAGAATCTTATCAATACATAAGAAATTTAGGAAGATTAGGTGCCAAAATACCCAGCACA
ATACTTGTATATTTTTAGTACCATACAGAAGTAAAATCCCAGGAACTATGAACACTAGAC
CTTATGTGGTTTATTCCTTCAATCATTTCAAACATTGAAAGTAGGGCCTACATGGTTATT
TGCCTGCTCACTTTATGTTTACATCTCCCACATTCATACCAATATACGTCAGGTTTGCTT
AACCATTGATTTTTTTTTTTTTTTACCAAGTCTTACAGTGATTATTTTACGTGTTTCCAT
GTATCTCACTTTGTGCTGTATTAAAAAAACCTCCATTTTGAAAATCTACGTTGTACAGAA
GCACATGTCTTTAATGTCTTCAGACAAAAAAGCCTTACATTAATTTAATGTTTGCACTCT
GAGGTGCAACTTAACAGGGAGGGCCTGAGAAAAGAATGGGAGGGGGCTATTAATTATTTT
TAGCAAAATGTTGCCTTTGTCTTGTGCAAACATGTAGAATATGCTCTTTAATTTAGTAAA
ATATTTTTTTAAAAGGTAGAGATGCTTTGTTATTGTAATCATAAACTTCCTGAAATTCTT
GTAATTTTTTTCCCATACTTATCAGAAGTGTGTTTACCAACTTATTTTTGTTTGAAAGTG
TGATTTTTTTTTTCCTTCCCAACCTCTCTTGCAAAAAAAGAAATGGGTTTCTGCTAATGA
ATTGAGCAGACATCTAATATTTTATATGCCTTTTGAGCTGTGTAACTTAATATTTGGATA
CTTGACAATTTGTTTTATTATGTAATTGATAAAATGGTGATGTGTATTAATGTTAGTTCA
ACCATATATTTATACTGTCTGGGGATGTGTGGTTATAGTTCTGTGGGAGAAATAATTTTG
TCAGTGTTCACCAGCTTGTAAAAACTTAGTGCGAGAGCTGAAACATCTAAATAAATAATG
ACATGCATTTATCATCATTGAGATTGGTTTGCTTAAAATTAACTTATTTTGTAGAAGACA
AAATGAATTGCACTTCACTTAATGTGTGTCCTCATCTTTTTACAAATAAATGAAGGATTA
TAAATGATGTCAGCATTTTAGTAAACTTTTAGACAAAATTTGTTAGGGTCATTCATGAAA
ACTTTAATACTAAAAGCACTTTCCATTATATACTTTTTAAAGGTCTAGATAATTTTGAAC
CAATTTATTATTGTGTACTGAGGAGAAATAATGTATAGTAGAGGACAGCCTTGGTTTGTA
AAGCTCAGTTCCACTAGTTCATGGTTTTGTGCAACTTCTGAGCCTCAGTTTTCTCCTTTG
CAAATTAATAATTACATACCTTTATAGATTTTGAAATTAATTTAAATATTAGTATTTGGT
ACATGAAGGCTTAATGTTAAGTTTCCTTTAATGATCCACAATAATCCCTTTGATCACGTT
AATCTAAATCTAGATGTCTTTGTCTAATTTTTTTTGAATAGCAGTTATAAATGTAAAGGA
CTCAAAGTTTAAGTAAAAAGTGATACTCCACCTTGTGTTTCAAAGAATTTAGTTCCACCT
CTTCATACCAGTTTAACACTTAATATATTTCATTGGATTTTAGACAGGGCAAAAGGAAGA
ACAGGGGCCTCTGGAGGCCCTTGGTTATTTAAATCTTGGATTATTTGTGATAGTAATCAC
AAATTTTTGGCTAATTTTTAACCTGAGGTTTTGTTTTTTTTTTAAAGGAAATGCAGCCTA
GTCTTGAGAACATAATTTTATATAATCAATTACTAAATGTTAAACTATTACCACACAGCC
CATAAAACAGCATTTGCGTTTATTGAGAGAGAGGATGTGCCATCATGATTAATGAAAACT
ATCTTTTGAGTTTGAAAAGAAATTAATTTGCAGTGTTTGGATTGTATATATGGTGCTAAA
AATAAATTAATTTACTTTATAAACCTTATCTGTACATTATACGATGTGATGAAATTTGCT
TTTTATCCAAATATTTTGTATCTTGTAAATATGGCTAATTATAGGAATGCCTATAATACA
TCTTAGATTCCTTATATCTAATAAGAGTTCAAAGAGTTATGAGTTGAAGTCTTGAATGCA
GGAAACTATCTGATAGTGTTCTAAAATTTGGTTACTTGGGTTTGGATACCCTTAGTGGGA
TGATGTAAATAGAGGCTAGCTACCTAGGCTTGTCTATAGCAACCATAATGTTGATGTAAG
TAATGCGGTTACTGAATCATAAGAAAATGCCATCTCTTTTTAGTTGAAGGAAAACTCTGG
AAGTAGGTGCCATTGGTCATTCTGCAGTGCACTGCAACCATTGTTTCCCCTAGTGCCCTC
TTTTCCCTAGGGCATTGCTCTCCTATTCCCACGCCTTAACACAGCTCTATACCTAGAAGC
AGCCAGCCCAGGCATGCAGTCACATTTAATCACATCCCCCTTCTAGAGTGCTTCAAAATG
ATGTAGTCCCTCAACTTGGCTAAAGAATCTCAATCTCTTGAAATTTATTTTTTTAATGTC
ATATTCATCTGGTAAATATCTACTGTTTGCCAGGCATTTAAGAATATGGCAAAGAACATA
AAAGATGGTGTCACCAGATTTTGGTCACCAATGAGTACCCGACCCGTTGCCATGATTAAG
AGAGAATGCTTTCTATTGGAGTTTCAGGAAATATAATTTGAGAATACTTTAAAGGGAAGT
GGAAGTATAAGTGAATGATATTTTTCTTTTACATGTAAACAATGAAGTTATTTCAAAGTT
AAGTTTTAAACAAAATACATGAAGTAGTGTCTGCCATACATGTTAATATTCTACATTCTT
GCTTCCTTAAATTAATATGTTTGTGTGTATATATGTGCCTCACACCTGAATTGAAAATTA
AAGACTGGTTTAAAAGTGGTTTAAAAGTGACATTTAATGTTTCTCCATTACGTTTGGGGT
AACCAGCCTAAGTGGAATCTTGGAAGGAAAGTAAGGGAAAAACTTGTATTTGCCTTCAAT
GAATTAAACCAGTGATATGTGTTAACGTATGAATGAAAGGATTGATGGTGATTTTATAAT
TATATATATTGCCGCAGTAACCAGTTAATAAATTGATAGCTACCATTTAAAAA

Protein Sequence

>7803 : length: 173
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEK
EGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALI
EGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ