ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7764

Name

ZNF217

Synonym

ZABC1;zinc finger protein 217;ZNF217;zinc finger protein 217

Definition

-

Position

20q13.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

7764

Links to epithelial mesenchymal transition gene database

7764

Links to ovarian cancer gene database

7764

Links to endometrial cancer gene database

7764

Links to iHOP

7764

Sequence Information

Nucleotide Sequence

>7764 : length: 5919
GGCTGAGGGCGGCGGCAGGATTTGAATCCAGGCGGTCTCTGGAGACTGGGTTCTGAGAAA
ACCCGCTGTGTGAGGGCTGGGGGGACCGCTTTAAGCCCTCCGCTGGAAGCGGTGAAGAAG
CTTTGGGCCAACGCAGTTCGGAGCGCCAGTGTAGACGCGTGGCTTCAGTTTGTCCTGCCT
GGCTCGACCTCCACTTTGGAGAAGATGCTCCAGGAACACTGAAGGGCAGGTCGTCCCCGA
CCTTCTATGAGGATTGCCCAGCTCAAGTATTGTTTGGAGCCAGGTAGAGTGAAGTCCTAC
AGAGTTATCAGGTTCCAGACCCTGCCTTCTCTTCTGAAAGGGTTTGGAAATCCCTTGTCT
CCAGGTTGCTGGGATTGACTTCTTGCTCAATTGAAACACTCATTCAATGGAGACAAAGAG
AACTAATGCTTTGTGCTGATTCATATTTGAATCGAGGCATTGGGAACCCTGTATGCCTTG
TTTGTGGAAAGAACCAGTGACACCATCACTGAGCTTCCTAAAAGTTCGAAGAAGTTAGAG
GACTATACACTTTCTTTTGAACTTTTATAATAAATATTTGCTCTGGTTTTTGGAACCCAG
GGCTGTTAGAGGGGTGAGTGACAAGTCTTACAAGTGGCCTTATTCCAACTCCAGAAATTG
CCCAACGGAACTTTGAGATTATATGCAATCGAAAGTGACAGGAAACATGCCAACTCAATC
CCTCTTAATGTACATGGATGGGCCAGAAGTGATTGGCAGCTCTCTTGGCAGTCCGATGGA
GATGGAGGATGCCTTGTCAATGAAAGGGACCGCTGTTGTTCCATTCCGAGCTACACAAGA
AAAAAATGTCATCCAAATCGAGGGGTATATGCCCTTGGATTGCATGTTCTGCAGCCAGAC
CTTCACACATTCAGAAGACCTTAATAAACATGTCTTAATGCAACACCGGCCTACCCTCTG
TGAACCAGCAGTTCTTCGGGTTGAAGCAGAGTATCTCAGTCCGCTTGATAAAAGTCAAGT
GCGAACAGAACCTCCCAAGGAAAAGAATTGCAAGGAAAATGAATTTAGCTGTGAGGTATG
TGGGCAGACATTTAGAGTCGCTTTTGATGTTGAGATCCACATGAGAACACACAAAGATTC
TTTCACTTACGGGTGTAACATGTGCGGAAGAAGATTCAAGGAGCCTTGGTTTCTTAAAAA
TCACATGCGGACACATAATGGCAAATCGGGGGCCAGAAGCAAACTGCAGCAAGGCTTGGA
GAGTAGTCCAGCAACGATCAACGAGGTCGTCCAGGTGCACGCGGCCGAGAGCATCTCCTC
TCCTTACAAAATCTGCATGGTTTGTGGCTTCCTATTTCCAAATAAAGAAAGTCTAATTGA
GCACCGCAAGGTGCACACCAAAAAAACTGCTTTCGGTACCAGCAGCGCGCAGACAGACTC
TCCACAAGGAGGAATGCCGTCCTCGAGGGAGGACTTCCTGCAGTTGTTCAACTTGAGACC
AAAATCTCACCCTGAAACGGGGAAGAAGCCTGTCAGATGCATCCCTCAGCTCGATCCGTT
CACCACCTTCCAGGCTTGGCAGCTGGCTACCAAAGGAAAAGTTGCCATTTGCCAAGAAGT
GAAGGAATCGGGGCAAGAAGGGAGCACCGACAACGACGATTCGAGTTCCGAGAAGGAGCT
TGGAGAAACAAATAAGGGCAGTTGTGCAGGCCTCTCGCAAGAGAAAGAGAAGTGCAAACA
CTCCCACGGCGAAGCGCCCTCCGTGGACGCGGATCCCAAGTTACCCAGTAGCAAGGAGAA
GCCCACTCACTGCTCCGAGTGCGGCAAAGCTTTCAGAACCTACCACCAGCTGGTCTTGCA
CTCCAGGGTCCACAAGAAGGACCGGAGGGCCGGCGCGGAGTCGCCCACCATGTCTGTGGA
CGGGAGGCAGCCGGGGACGTGTTCTCCTGACCTCGCCGCCCCTCTGGATGAAAATGGAGC
CGTGGATCGAGGGGAAGGTGGTTCTGAAGACGGATCTGAGGATGGGCTTCCCGAAGGAAT
CCATCTGGATAAAAATGATGATGGAGGAAAAATAAAACATCTTACATCTTCAAGAGAGTG
TAGTTATTGTGGAAAGTTTTTCCGTTCAAATTATTACCTCAATATTCATCTCAGAACGCA
TACAGGTGAAAAACCATACAAATGTGAATTTTGTGAATATGCTGCAGCCCAGAAGACATC
TCTGAGGTATCACTTGGAGAGACATCACAAGGAAAAACAAACCGATGTTGCTGCTGAAGT
CAAGAACGATGGTAAAAATCAGGACACTGAAGATGCACTATTAACCGCTGACAGTGCGCA
AACCAAAAATTTGAAAAGATTTTTTGATGGTGCCAAAGATGTTACAGGCAGTCCACCTGC
AAAGCAGCTTAAGGAGATGCCTTCTGTTTTTCAGAATGTTCTGGGCAGCGCTGTCCTCTC
ACCAGCACACAAAGATACTCAGGATTTCCATAAAAATGCAGCTGATGACAGTGCTGATAA
AGTGAATAAAAACCCTACCCCTGCTTACCTGGACCTGTTAAAAAAGAGATCAGCAGTTGA
AACTCAGGCAAATAACCTCATCTGTAGAACCAAGGCGGATGTTACTCCTCCTCCGGATGG
CAGTACCACCCATAACCTTGAAGTTAGCCCCAAAGAGAAGCAAACGGAGACCGCAGCTGA
CTGCAGATACAGGCCAAGTGTGGATTGTCACGAAAAACCTTTAAATTTATCCGTGGGGGC
TCTTCACAATTGCCCGGCAATTTCTTTGAGTAAAAGTTTGATTCCAAGTATCACCTGTCC
ATTTTGTACCTTCAAGACATTTTATCCAGAAGTTTTAATGATGCACCAGAGACTGGAGCA
TAAATACAATCCTGACGTTCATAAAAACTGTCGAAACAAGTCCTTGCTTAGAAGTCGACG
TACCGGATGCCCGCCAGCGTTGCTGGGAAAAGATGTGCCTCCCCTCTCTAGTTTCTGTAA
ACCCAAGCCCAAGTCTGCTTTCCCGGCGCAGTCCAAATCCCTGCCATCTGCGAAGGGGAA
GCAGAGCCCTCCTGGGCCAGGCAAGGCCCCTCTGACTTCAGGGATAGACTCTAGCACTTT
AGCCCCAAGTAACCTGAAGTCCCACAGACCACAGCAGAATGTGGGGGTCCAAGGGGCCGC
CACCAGGCAACAGCAATCTGAGATGTTTCCTAAAACCAGTGTTTCCCCTGCACCGGATAA
GACAAAAAGACCCGAGACAAAATTGAAACCTCTTCCAGTAGCTCCTTCTCAGCCCACCCT
CGGCAGCAGTAACATCAATGGTTCCATCGACTACCCCGCCAAGAACGACAGCCCGTGGGC
ACCTCCGGGAAGAGACTATTTCTGTAATCGGAGTGCCAGCAATACTGCAGCAGAATTTGG
TGAGCCCCTTCCAAAAAGACTGAAGTCCAGCGTGGTTGCCCTTGACGTTGACCAGCCCGG
GGCCAATTACAGAAGAGGCTATGACCTTCCCAAGTACCATATGGTCAGAGGCATCACATC
ACTGTTACCGCAGGACTGTGTGTATCCGTCGCAGGCGCTGCCTCCCAAACCAAGGTTCCT
GAGCTCCAGCGAGGTCGATTCTCCAAATGTGCTGACTGTTCAGAAGCCCTATGGTGGCTC
CGGGCCACTTTACACTTGTGTGCCTGCTGGTAGTCCAGCATCCAGCTCGACGTTAGAAGG
TCTTGGTGGATGTCAGTGCTTACTCCCCATGAAATTAAATTTTACTTCATCCTTTGAGAA
GCGAATGGTGAAAGCTACTGAAATAAGCTGTGATTGTACTGTACATAAAACATATGAGGA
ATCTGCAAGGAACACTACAGTTGTGTAAAGTTGTTCTGTTAACTTTTGTACCAAATAGCA
ATACAAACTAGTTGGAACAGTTGGAACTTACATACATGGGGACTGGAAATCTCTATTTTG
TCCCTGAATAATATTTTTCTTAGAATTGACCAAATAAGAAGTGGAATTTTTGCATACTTG
AGCGCTGCTGAAAAGAAATCATTTGGGTTGGGTGGGGCGGGATGGGGGAAAAGTATATAA
TGCTTGCACCTCAGGTAAAAATCTGTAAATATCTAAGTTGTAAACCTGCTTGTTCAAATA
CTGTGTGTATTCCTTTTCTCTAATGCAGCTCATCACTTGGAGCAGTTTCTGCTATTGTGC
TCTTTCATTTAAAATGTATGTTTTTTTTTTTTTAAACTGTCAATGATTTTGTATTATGTT
GAATCCACCCAAATCTATTGTTGTCTTAAAATTGTTAATGGAAGTATTGACCCTCTATGA
TATGTGCTGCAGATATCGAGGTCAGCCATTCGGAAGCTGGCAGCATTTTATCGCAACTTT
GAGCATCTCAGATGGGGAAGGCACCTTCTTCCTCGCCTCTCCAGATTGTCCTGGAACCTC
CAGGATCCTTGACTGAGGGCGTTGGGATGGCTTGTAGGATTTTTAAGAGAGTGTGTCTAC
AGACAAGCATTTTCTCTGTAGAGCAGCCACACGTTGTATAAACATAAACTGTATGTGCAG
TTATTTAAATTTGTTTCTGTCAAATTAATCATTTTTGTTGGACGATTCAGTGGCGGGGGG
GTTTTGCCTAAATTAGTATATAAAAACAAAAATGCTAAATTATATCTGTGAATTGCAGGT
ATTGGGGAACAGTTTTAAGGGAAATTTTGGGGGGAACATTTTAGGTTTGTATTTGGTAGT
CTTAATGTATCTGGCATTTGGGTGAACTGTGGACATACTAGAGTTGATTATAGACACATT
GATTTTGAATAAGGAACTGCTGGCCGAGCCCGCTGGGAGTCTAGAAAGAGAAAATCTGTT
TCTAGACCTCAGTTATTTTCCCATTTTTGGTTGTTTTGAAGCAGTAACATTTTTCTCAGT
GCACATGCAATTTGGGTTTTAGAGAAGATGGCCACCAGCTGGCTTCCTAGATATTTTAAA
CTTTTGTTCTTTAATATGCTGTCCATGGCTGAGTTTATTAGTACATGGGCTTAGTGACCA
CAAAATATTTTATTAAGAAACTGTTTCAAAAATAAATTTGCACTGTTCATTTTTCTGGCC
TCGCTGTTCTCCATAGAGCAAGGGTAATCCTAGAAAAAATTTTTTTTTTTTAAATTATGC
AACGTAAGATGTCCTCCTTGATAGAAGTCTTAGCTCCTGTGTTACAAGGGAGAACTCATT
TGAGATCAGTCTGTTGGCATTGCAATGAAGTGCTTTGTATCAGGAAAGTGTACACTATTG
ACCTTTTTTCCTGTTCACAAGCTGAGCCATATGTACATAATCTAGATTTTGTTTTCATAG
TTTTGCACTTTTATAGCCTATTTTTGAAGATTAACACATTTGCAAGATGATTGACTCAAT
CTTTGCCTAATCCAATGAGTGTTACAGAGAGCTTGCTGTGACTAGAACCATAAATCTTAA
AGGGGGTATGTGATAATAGAGGGCTGGAATTTAAACCTGTATTTAAAAAAAAGAATCACC
AAATCTATTTGAAAACAAGTCGATTTGTATTATGCTGGAATTTTTTGGGCTTTCAGATTT
CTCTTTTTAACCACATTTCTGAATGTATAAAAATACCAATTATTTTCCTACAGCCCTTTG
TACTTCAAAATATGTTTTTGTGTCCATCAGTATTAACTATTGGTATACTACTGGTTTTAT
ATTTTTTTTTCTTTGAGACAACAGTACATATAATAGAGGTACAATTCGTTGGATTTTTGT
TTATGTATTTATTTCATTCCAGTTTGATTTATTTTAATTGTTGATACTTAAGTTGTCGAA
CAGTAGACATTACTTGTTTTATTTATGATATATTTCAGCTTAAAGTTATGTTATTATATG
TGGAAGTGTAAATATAGATTTGGTGTTTTGCAATCTTGA

Protein Sequence

>7764 : length: 1061
MQSKVTGNMPTQSLLMYMDGPEVIGSSLGSPMEMEDALSMKGTAVVPFRATQEKNVIQIE
GYMPLDCMFCSQTFTHSEDLNKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTEPPKE
KNCKENEFSCEVCGQTFRVAFDVEIHMRTHKDSFTYGCNMCGRRFKEPWFLKNHMRTHNG
KSGARSKLQQGLESSPATINEVVQVHAAESISSPYKICMVCGFLFPNKESLIEHRKVHTK
KTAFGTSSAQTDSPQGGMPSSREDFLQLFNLRPKSHPETGKKPVRCIPQLDPFTTFQAWQ
LATKGKVAICQEVKESGQEGSTDNDDSSSEKELGETNKGSCAGLSQEKEKCKHSHGEAPS
VDADPKLPSSKEKPTHCSECGKAFRTYHQLVLHSRVHKKDRRAGAESPTMSVDGRQPGTC
SPDLAAPLDENGAVDRGEGGSEDGSEDGLPEGIHLDKNDDGGKIKHLTSSRECSYCGKFF
RSNYYLNIHLRTHTGEKPYKCEFCEYAAAQKTSLRYHLERHHKEKQTDVAAEVKNDGKNQ
DTEDALLTADSAQTKNLKRFFDGAKDVTGSPPAKQLKEMPSVFQNVLGSAVLSPAHKDTQ
DFHKNAADDSADKVNKNPTPAYLDLLKKRSAVETQANNLICRTKADVTPPPDGSTTHNLE
VSPKEKQTETAADCRYRPSVDCHEKPLNLSVGALHNCPAISLSKSLIPSITCPFCTFKTF
YPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAF
PAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSE
MFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYF
CNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCV
YPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGLGGCQCL
LPMKLNFTSSFEKRMVKATEISCDCTVHKTYEESARNTTVV