ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7704

Name

ZBTB16

Synonym

PLZF|ZNF145;zinc finger and BTB domain containing 16;ZBTB16;zinc finger and BTB domain containing 16

Definition

promyelocytic leukaemia zinc finger|zinc finger and BTB domain-containing protein 16|zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia)|zinc finger protein PLZF

Position

11q23.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

map kinase inactivation of smrt corepressor;PID BioCarta;100032

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Cancers;KEGG DISEASE

Disease

PSYCH;GAD

Disease

Acute myeloid leukemia (AML);KEGG DISEASE;H00003

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Conduct disorder (interaction);NHGRI

Disease

Conduct disorder (interaction);GAD

Disease

Leukemia, acute promyelocytic, PL2F/RARA type;OMIM

Disease

Skeletal defects, genital hypoplasia, and mental retardation;OMIM

External Links

Links to cell senescence gene database

7704

Links to epithelial mesenchymal transition gene database

7704

Links to ovarian cancer gene database

7704

Links to endometrial cancer gene database

7704

Links to iHOP

7704

Sequence Information

Nucleotide Sequence

>7704 : length: 2417
GCAGCAGAGAGGAGTTGAGGGCGATGAGAGCGGGTACTGCGAACTGCCGGGCGATGCTGT
CGCTGCCGCCGTGATACGGAGAGCAACAGTTCCCCAGCAACACCCCTCCCCGACACAGGC
ACACACCCCCCGACAGGCACGCACACCCACCCCACAGTGCCCGGCTCGGCTGCGCCTCCT
CTATTGGCCCAGGAAGCCCACCCAGCCCCGCCACGCAGAGCCCAGAAGGAAAGAAAGCCT
CATGCCTGAGCCGAGGGGAGCACCATGGATCTGACAAAAATGGGCATGATCCAGCTGCAG
AACCCTAGCCACCCCACGGGGCTACTGTGCAAGGCCAACCAGATGCGGCTGGCCGGGACT
TTGTGCGATGTGGTCATCATGGTGGACAGCCAGGAGTTCCACGCCCACCGGACGGTGCTG
GCCTGCACCAGCAAGATGTTTGAGATCCTCTTCCACCGCAATAGTCAACACTATACTTTG
GACTTCCTCTCGCCAAAGACCTTCCAGCAGATTCTGGAGTATGCATATACAGCCACGCTG
CAAGCCAAGGCGGAGGACCTGGATGACCTGCTGTATGCGGCCGAGATCCTGGAGATCGAG
TACCTGGAGGAACAGTGCCTGAAGATGCTGGAGACCATCCAGGCCTCAGACGACAATGAC
ACGGAGGCCACCATGGCCGATGGCGGGGCCGAGGAAGAAGAGGACCGCAAGGCTCGGTAC
CTCAAGAACATCTTCATCTCGAAGCATTCCAGCGAGGAGAGTGGGTATGCCAGTGTGGCT
GGACAGAGCCTCCCTGGGCCCATGGTGGACCAGAGCCCTTCAGTCTCCACTTCATTTGGT
CTTTCAGCCATGAGTCCCACCAAGGCTGCAGTGGACAGTTTGATGACCATAGGACAGTCT
CTCCTGCAGGGAACTCTTCAGCCACCTGCAGGGCCCGAGGAGCCAACTCTGGCTGGGGGT
GGGCGGCACCCTGGGGTGGCTGAGGTGAAGACGGAGATGATGCAGGTGGATGAGGTGCCC
AGCCAGGACAGCCCTGGGGCAGCCGAGTCCAGCATCTCAGGAGGGATGGGGGACAAGGTT
GAGGAAAGAGGCAAAGAGGGGCCTGGGACCCCGACTCGAAGCAGCGTCATCACCAGTGCT
AGGGAGCTACACTATGGGCGAGAGGAGAGTGCCGAGCAGGTGCCACCCCCAGCTGAGGCT
GGCCAGGCCCCCACTGGCCGACCTGAGCACCCAGCACCCCCGCCTGAGAAGCATCTGGGC
ATCTACTCCGTGTTGCCCAACCACAAGGCTGACGCTGTATTGAGCATGCCGTCTTCCGTG
ACCTCTGGCCTCCACGTGCAGCCTGCCCTGGCTGTCTCCATGGACTTCAGCACCTATGGG
GGGCTGCTGCCCCAGGGCTTCATCCAGAGGGAGCTGTTCAGCAAGCTGGGGGAGCTGGCT
GTGGGCATGAAGTCAGAGAGCCGGACCATCGGAGAGCAGTGCAGCGTGTGTGGGGTCGAG
CTTCCTGATAACGAGGCTGTGGAGCAGCACAGGAAGCTGCACAGTGGGATGAAGACGTAC
GGGTGCGAGCTCTGCGGGAAGCGGTTCCTGGATAGTTTGCGGCTGAGAATGCACTTACTG
GCTCATTCAGCGGGTGCCAAAGCCTTTGTCTGTGATCAGTGCGGTGCACAGTTTTCGAAG
GAGGATGCCCTGGAGACACACAGGCAGACCCATACTGGCACTGACATGGCCGTCTTCTGT
CTGCTGTGTGGGAAGCGCTTCCAGGCGCAGAGCGCACTGCAGCAGCACATGGAGGTCCAC
GCGGGCGTGCGCAGCTACATCTGCAGTGAGTGCAACCGCACCTTCCCCAGCCACACGGCT
CTCAAACGCCACCTGCGCTCACATACAGGCGACCACCCCTACGAGTGTGAGTTCTGTGGC
AGCTGCTTCCGGGATGAGAGCACACTCAAGAGCCACAAACGCATCCACACGGGTGAGAAA
CCCTACGAGTGCAATGGCTGTGGCAAGAAGTTCAGCCTCAAGCATCAGCTGGAGACGCAC
TATAGGGTGCACACAGGTGAGAAGCCCTTTGAGTGTAAGCTCTGCCACCAGCGCTCCCGG
GACTACTCGGCCATGATCAAGCACCTGAGAACGCACAACGGCGCCTCGCCCTACCAGTGC
ACCATCTGCACAGAGTACTGCCCCAGCCTCTCCTCCATGCAGAAGCACATGAAGGGCCAC
AAGCCCGAGGAGATCCCGCCCGACTGGAGGATAGAGAAGACGTACCTCTACCTGTGCTAT
GTGTGAAGGGAGGCCCGCGGCGGTGGAGCCGAGCGGGGAGCCAGGAAAGAAGAGTTGGAG
TGAGATGAAGGAAGGACTATGACAAATAAAAAAGGAAAAGAAAAAAAAAAACAGAAGGAA
AAGGAAAAAAAAAAAAA

Protein Sequence

>7704 : length: 673
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
MLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV