ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7546

Name

ZIC2

Synonym

HPE5;Zic family member 2;ZIC2;Zic family member 2

Definition

Zic family member 2 (odd-paired homolog, Drosophila)|Zinc finger protein of the cerebellum 2|zinc finger protein ZIC 2

Position

13q32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Disease

neural tube defects;GAD

Disease

Holoprosencephaly-5;OMIM

Disease

DEVELOPMENTAL;GAD

External Links

Links to cell senescence gene database

7546

Links to epithelial mesenchymal transition gene database

7546

Links to ovarian cancer gene database

7546

Links to endometrial cancer gene database

7546

Links to iHOP

7546

Sequence Information

Nucleotide Sequence

>7546 : length: 2991
CCGCCTGGCTTTGGACTCTTCTCCTCCTCCACCTCCTCCTCCTCCTCCCGCGCCGCCGCC
TCCTCCTCCTCTTCCTCTCCGCGCCTTCGCTACGCGCCCGGCCGCCCGAGGCAGATCCAG
GCGGCGGCGGAGGCGGCGGGCGCAGGAGAGCGGCTCCCAGGGCTGAAGTGGCCGCCACCA
CCGCCGCCTGCGCCTGGAGCCCGGTGGCCGCCGGACGCACCGCGCGGATCGGGAGCGGGA
GTCGAGGCGGCGCGGAGGCGCAGGGCTCGCAGGGGCGGGCGGGCGCGCTGGCCATGCTCC
TGGACGCGGGTCCGCAGTTCCCGGCCATCGGGGTGGGCAGCTTCGCGCGCCACCATCACC
ACTCCGCCGCGGCGGCGGCGGCGGCTGCCGCCGAGATGCAGGACCGTGAACTGAGCCTGG
CGGCGGCGCAGAACGGCTTCGTTGACTCCGCCGCCGCGCACATGGGAGCCTTCAAGCTCA
ACCCGGGCGCGCACGAGCTGTCCCCGGGCCAGAGCTCGGCGTTCACGTCGCAGGGCCCCG
GCGCCTACCCCGGCTCCGCTGCGGCTGCCGCTGCGGCCGCAGCGCTCGGGCCCCACGCCG
CGCACGTTGGCTCCTACTCTGGGCCGCCCTTCAACTCCACCCGGGACTTCCTGTTCCGCA
GCCGCGGCTTCGGGGACTCGGCGCCGGGCGGCGGGCAGCACGGGCTGTTCGGGCCGGGCG
CGGGCGGCCTGCACCACGCGCACTCGGACGCGCAGGGCCACCTCCTCTTCCCGGGCCTGC
CAGAGCAGCACGGGCCGCACGGCTCGCAGAATGTGCTCAACGGGCAGATGCGCCTCGGGC
TGCCCGGCGAGGTGTTCGGGCGCTCGGAGCAATACCGCCAGGTGGCCAGCCCGCGGACCG
ACCCCTACTCGGCGGCGCAACTCCACAACCAGTACGGCCCCATGAATATGAACATGGGTA
TGAACATGGCAGCAGCCGCGGCCCACCACCACCACCACCACCACCACCACCCCGGTGCCT
TTTTCCGCTATATGCGGCAGCAGTGCATCAAGCAGGAGCTAATCTGCAAGTGGATCGACC
CCGAGCAACTGAGCAATCCCAAGAAGAGCTGCAACAAAACTTTCAGCACCATGCACGAGC
TGGTGACACACGTCTCGGTGGAGCACGTCGGCGGCCCGGAGCAGAGCAACCACGTCTGCT
TCTGGGAGGAGTGTCCGCGCGAGGGCAAGCCCTTCAAGGCCAAATACAAACTGGTCAACC
ACATCCGCGTGCACACAGGCGAGAAACCCTTCCCCTGCCCCTTCCCGGGCTGTGGCAAAG
TCTTCGCGCGCTCCGAGAACCTCAAGATCCACAAAAGGACCCACACAGGGGAGAAGCCGT
TCCAGTGTGAGTTTGAGGGCTGCGACCGGCGCTTCGCCAACAGCAGCGACAGGAAGAAGC
ACATGCACGTCCACACCTCCGATAAGCCCTATCTCTGCAAGATGTGCGACAAGTCCTACA
CGCACCCCAGCTCGCTGCGGAAGCACATGAAGGTCCATGAGTCCTCCCCGCAGGGCTCTG
AATCCTCCCCGGCCGCCAGCTCCGGCTATGAGTCGTCCACGCCCCCGGGGCTGGTGTCCC
CCAGCGCCGAGCCCCAGAGCAGCTCCAACCTGTCCCCAGCGGCGGCGGCAGCGGCGGCGG
CGGCTGCGGCGGCGGCGGCCGCGGTGTCCGCGGTGCACCGGGGCGGAGGCTCGGGCAGTG
GCGGCGCGGGAGGCGGCTCAGGCGGCGGCAGCGGCAGTGGCGGGGGCGGCGGCGGGGCGG
GCGGCGGGGGCGGCGGCAGCTCTGGCGGGGGCAGCGGGACAGCCGGGGGTCACAGCGGCC
TCTCCTCCAACTTCAATGAATGGTACGTGTGACGGGTCGGGGCCTCTCTCCCTCTCCCTG
TCCCCACCCCAGCGCAGCAGCCCTCCCCGCAGCTAGCAGCGAGGGCACCTTGTGATCATG
TTGTTAAAATTATGAATCTGATTTTTATGATGATGAAAATTTTACCAGCAGAAGGATTTT
TTAAAGTTTTTTTTTTTTTTTTAATAATAATCTAGGCATGAAGAGCAAAAATATCCCTTC
CGGAGTCTTTGAAGCTGAAAATATAAAACAAATAAAAAATAAAAAAATAAAAACCCACAA
AAATGTTGAACCAAACCTCCCTGCTAATCTCCATGCCCACGTTCTTTCCCACCCTGTTCC
CAGTCTTCTGACAAACTGTGTACATAGCGGACTCCTCCTTTCTCCTCCGAGGTGGTTTTA
AAGGCTTTTTGGTGTATAGAAGTTTGTCCATTTGTAAAACTCCGGATTGCGTTCCTCCCC
GCCTTCCGCCCCTTCCCTTCCCTAAAGTGATGGGCTTTCTCTTTTCTCTTTTTAGTTTAC
CCGGTTTCTTTTTAAGTAATGTGGAAGAAAATGGTTTATTTTGTATTGTGGTATTGAATA
TTGTGTTCCTTTTTATGAGGCAACCTGATTGTAAACTTCATGTAACTATAGACTGGAAAA
AATGAGCCGTGCCAAAGTCTCCCTTCTGTTTCTTCAGCACATTGACCCATAGCACACACA
TACACACCACCACCAACAACGCTTGTGAATGTATTTTTCTGTTAGCTGGGTTTACATGTG
ATGTTTTAGTGCTTTTGCAAGTTCAATTTGTTAGTTCCTGTATGAAAGATTGTGGGGGAA
AAATAAACGTCGTGCCGTTAGCTTTTTCCGTAATAACACCCTTCCTTCTGTAAATACCCG
TTACCATATTTATCCATTTGTAATTAAATTATGGTATTAACTTGCTACAGAGGAAACAAT
ATTTATAAAGAATGTTTCTTAACTATAAATATGTACAATTGTGGGCATAAACTGTTTCAG
ATTTTTTATTTGAAGGTTTTAAGTGGTTTGATCATTTCTTGTGATGTTTTGAGAGTAATG
CATACAGAAATATAATAAAATGTGTTGAAACTGCAAAAAAAAAAAAAAAAA

Protein Sequence

>7546 : length: 532
MLLDAGPQFPAIGVGSFARHHHHSAAAAAAAAAEMQDRELSLAAAQNGFVDSAAAHMGAF
KLNPGAHELSPGQSSAFTSQGPGAYPGSAAAAAAAAALGPHAAHVGSYSGPPFNSTRDFL
FRSRGFGDSAPGGGQHGLFGPGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMR
LGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNMNMGMNMAAAAAHHHHHHHHHP
GAFFRYMRQQCIKQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNH
VCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGE
KPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSPQ
GSESSPAASSGYESSTPPGLVSPSAEPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGGGS
GSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSGLSSNFNEWYV