ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

754

Name

PTTG1IP

Synonym

C21orf1|C21orf3|PBF;pituitary tumor-transforming 1 interacting protein;PTTG1IP;pituitary tumor-transforming 1 interacting protein

Definition

PTTG-binding factor|pituitary tumor-transforming gene 1 protein-interacting protein|pituitary tumor-transforming gene protein-binding factor

Position

21q22.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

754

Links to epithelial mesenchymal transition gene database

754

Links to ovarian cancer gene database

754

Links to endometrial cancer gene database

754

Links to iHOP

754

Sequence Information

Nucleotide Sequence

>754 : length: 2843
ATCCGCGCCGCGCAGGCGCACTGAGCCTCAGCCGCTCTCCTCGCTACCAGGCTCCTTTCC
TCTATCGCGCAGGCGCACTGAACCTCAGCCGCGCCGGGAGGCGAGCCCGTTGGCGAGGGG
CGGGGCAGATGGCGAGGGAGCGGGGCGAGCTGCTTTTTGAGGCTGCGCACTCGCATGGCC
CCACCTCGCAGGTCCACTTCCGGCGCCGCGGCTGTTCCGGGCGGAGACCGCTTGTGCTGG
AGTCGGAGTTGTAACGCTCCACTGACTGATAGAGCGACCGGCCGACCATGGCGCCCGGAG
TGGCCCGCGGGCCGACGCCGTACTGGAGGTTGCGCCTCGGTGGCGCCGCGCTGCTCCTGC
TGCTCATCCCGGTGGCCGCCGCGCAGGAGCCTCCCGGAGCTGCTTGTTCTCAGAACACAA
ACAAAACCTGTGAAGAGTGCCTGAAGAACGTCTCCTGTCTTTGGTGCAACACTAACAAGG
CTTGTCTGGACTACCCAGTTACAAGCGTCTTGCCACCGGCTTCCCTTTGTAAATTGAGCT
CTGCACGCTGGGGAGTTTGTTGGGTGAACTTTGAGGCGCTGATCATCACCATGTCGGTAG
TCGGGGGAACCCTCCTCCTGGGCATTGCCATCTGCTGCTGCTGCTGCTGCAGGAGGAAGA
GGAGCCGGAAGCCGGACAGGAGTGAGGAGAAGGCCATGCGTGAGCGGGAGGAGAGGCGGA
TACGGCAGGAGGAACGGAGAGCAGAGATGAAGACAAGACATGATGAAATCAGAAAAAAAT
ATGGCCTGTTTAAAGAAGAAAACCCGTATGCTAGATTTGAAAACAACTAAAGCGCTCCAG
CACATCAGTCCCGACGCTTCCTGTGAGGTGCACGCTCCGCAGCCCAGCCCAGCCGGGAGA
CCACGTGGCCATTGCGGTCTCCTGACCTTGGCCAGTGAACCTGCCAGCCTTCCAGGACAG
GCGGCCGGAGAGCTGCCCCTGAAGGACAGTCCTCTCGTCTTGCAGACTGGTGACCTTCTA
TTCCCTGTTCATCTCTGTTTCTAGATTTAGTCACTTGAAATAAGAAATCTTTGGGGTTTG
GGCTTTTTTATACTCTTCTCAGTTTGTGAAACGCTAACTGCACACGAAGCCGCCTGACGG
CACCCAGCGCTGTGGCTGTCATTCTCCCAGGGCAGAACCCTGCGTTTCTCTCTGTCCACT
AACAAGCTTCACACGCAACACAGGGAAGTCGGTTTGACTTTTGTCATGAGGAGAACTGAC
CAGCCCTCATCATTCCCCATAAAACCACGGACAGCGTCTGTGTGCGCATCTTGAGTCTTC
ACACCTGTTGACTCACACGGCTTTTGCTGATGACACGGGGCTCCAGTACACAGTCTGATA
AGGACTTAACGTCCTAACCTCAATTGTATTAAATAGCATTGGGGAATAGCTAAACCTTTT
TAAAAAAATTTATTGGATTTTCCTCCCTGCTTAAAAGATTTCACCAGAAAACCTTCATAT
AAAAATTCAGGCCCTTTTTGGACAATTTTTAAAATTTGTATCTTTACTAGAACATGAGAA
TCTTTTTCCCTTGGAAGCTTGAATTATAAATGTGGTGTTTGGCCTGCCTCAGCAGCACCA
GTTGACTGCTCGTGTGCCAGCGGTGTGGGGAGGACGGGGCAGGACGCTGCAGCTCTCTCC
AGCCCTGTTGGCATCCTCAGTGCCTGCAGGCCTCTCGCTGCCTGTTGGGCTGTCTGGGGG
GTGGCCATTTAGGGATCGTGGGGACGGGGTCCACCCCAAGAAGAAAGAAAGGCCCGTCCA
CAGGCCCGGCTCTGGGCCACGTGCCCCGGAAGCAGGTGTGTCCAGAGTCAGCTGAGGGCT
CTCCCCACACCACCCAGCAGGCGCTGGTGCTCCTTCTGCCTCATGGGACCAGTCCAGCTT
CCAGCCGCTCTGGCTCGAGGGTGGTCTGACCACTTCCTTCTGAGTGGGCTTCTCTGGGAG
CTCTCCAGTGGCACTGCTGGACCTGCCCACGTTTCTGTAAAATCAGGATACGTGGCTTTA
GTAAGCAGACCAAGCGCTTCGTGGCAGGGAAAGCAGCGTGCGGGGAAGTCACTGAAAAGT
GCTGCCTAAGGAAGTTTGGAAATAGTCCCTGTTCCAGATTGCCTTGAATTTTAAAACATT
TTGCTTTGGGAAAGTAGGTCAGCAGCACCTAAGATCAAGGATGCGTTCCATTTTCACACT
TCACAGTCATGAAAACTGAGAAGACTGTCTTCAGCGTGAACTAAAGTTCACAGGCAGATC
ACTGATCCAGAACACTTCAAGAACTCGTCAAACAGCTCGATAAGCCTTTTTGACTGTGTA
CATCTGTACCGGGAATAACATTCCTAGGCTGAAATTTCCACAAAGAATAGAACCTGTACC
CAGTTCTTCAGGCTGATTTCCCTGACCTCTTGGGCATTTGTATTTGTAGTAAAGTATTGC
AGAGATTCCTAAGTATTTTATAGCAGCCATCAAAATTGGACTTTGTATTGTTTATTCATA
AAAGACACTTGGTAATAGACTTCAGTGAACTCTGTATGAATGCAGTAGTGTGTGTGCAAA
ATCCGCTTCCTGAGCGTAGGGTGCTGAGCTGGCGCTAGGGCTCGGTTGTGAAATACAGCG
TAGTCAGCCCTTGCGCTCAGTGTAGAAACCCACGTCTGTAAGGTCGGTCTTCGTCCATCT
GCTTTTTTCTGAAATACACTAAGAGCAGCCACAAAACTGTAACCTCAAGGAAACCATAAA
GCTTGGAGTGCCTTAATTTTTAACCAGTTTCCAATAAAACGGTTTACTACCTGCGTGTGT
TTAGTAAAAAAAAAAAAAAAAAA

Protein Sequence

>754 : length: 180
MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWC
NTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCC
CRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN