ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

7534

Name

YWHAZ

Synonym

14-3-3-zeta|HEL-S-3|HEL4|KCIP-1|YWHAD;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta;YWHAZ;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta

Definition

14-3-3 delta|14-3-3 protein zeta/delta|14-3-3 protein/cytosolic phospholipase A2|14-3-3 zeta|epididymis luminal protein 4|epididymis secretory protein Li 3|phospholipase A2|protein kinase C inhibitor protein 1|protein kinase C inhibitor protein-1|tyrosine

Position

8q23.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

p38 signaling mediated by MAPKAP kinases;PID Curated;200135

Pathway

Parkinson disease;PANTHER;P00049

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Hemostasis;Reactome;REACT:604

Pathway

ErbB1 downstream signaling;PID Curated;200113

Pathway

GMCSF-mediated signaling events;PID Curated;200015

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

IGF1 pathway;PID Curated;200084

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Disease

Attention deficit hyperactivity disorder and conduct disorder;GAD

Disease

PSYCH;GAD

Disease

Attention deficit hyperactivity disorder and conduct disorder;NHGRI

External Links

Links to cell senescence gene database

7534

Links to epithelial mesenchymal transition gene database

7534

Links to ovarian cancer gene database

7534

Links to endometrial cancer gene database

7534

Links to iHOP

7534

Sequence Information

Nucleotide Sequence

>7534 : length: 3387
TTCCCCTTCTTCCGGGCTCCCGTCCCGGCTCATCACCCGGCCTGTGGCCCACTCCCACCG
CCAGCTGGAACCCTGGGGACTACGACGTCCCTCAAACCTTGCTTCTAGGAGATAAAAAGG
CCTCACCTCCTGCCGGCTCCGCCCGGCCCGGCCCACCTCGCCCCCACCTCGGCGCCCACC
CATTGTCCCCTCGCGCAGTCACCGAGCGCAGATCCCGCGCTCTCGATTGGAACGCCTCCC
CATCACTCAGCCACACTCAGGGGCTGGACGCCTCACTCCCGTTTCCGAGCCATAAAAGGT
CTAGGACCGCTTCCCCCGAGCCAGCAGCGTTTGACGTCATCGTGCGTGTGGTGCCCCTGC
TGCCGGGGCTGGTGATTGGAGGAAACCCCGTGTCTGCGGAGCGGCTGTAGCCTGTGAGCA
GCGAGATCCAGGGACAGAGTCTCAGCCTCGCCGCTGCTGCCGCCGCCGCCGCCCAGAGAC
TGCTGAGCCCGTCCGTCCGCCGCCACCACCCACTCCGGACACAGAACATCCAGTCATGGA
TAAAAATGAGCTGGTTCAGAAGGCCAAACTGGCCGAGCAGGCTGAGCGATATGATGACAT
GGCAGCCTGCATGAAGTCTGTAACTGAGCAAGGAGCTGAATTATCCAATGAGGAGAGGAA
TCTTCTCTCAGTTGCTTATAAAAATGTTGTAGGAGCCCGTAGGTCATCTTGGAGGGTCGT
CTCAAGTATTGAACAAAAGACGGAAGGTGCTGAGAAAAAACAGCAGATGGCTCGAGAATA
CAGAGAGAAAATTGAGACGGAGCTAAGAGATATCTGCAATGATGTACTGTCTCTTTTGGA
AAAGTTCTTGATCCCCAATGCTTCACAAGCAGAGAGCAAAGTCTTCTATTTGAAAATGAA
AGGAGATTACTACCGTTACTTGGCTGAGGTTGCCGCTGGTGATGACAAGAAAGGGATTGT
CGATCAGTCACAACAAGCATACCAAGAAGCTTTTGAAATCAGCAAAAAGGAAATGCAACC
AACACATCCTATCAGACTGGGTCTGGCCCTTAACTTCTCTGTGTTCTATTATGAGATTCT
GAACTCCCCAGAGAAAGCCTGCTCTCTTGCAAAGACAGCTTTTGATGAAGCCATTGCTGA
ACTTGATACATTAAGTGAAGAGTCATACAAAGACAGCACGCTAATAATGCAATTACTGAG
AGACAACTTGACATTGTGGACATCGGATACCCAAGGAGACGAAGCTGAAGCAGGAGAAGG
AGGGGAAAATTAACCGGCCTTCCAACTTTTGTCTGCCTCATTCTAAAATTTACACAGTAG
ACCATTTGTCATCCATGCTGTCCCACAAATAGTTTTTTGTTTACGATTTATGACAGGTTT
ATGTTACTTCTATTTGAATTTCTATATTTCCCATGTGGTTTTTATGTTTAATATTAGGGG
AGTAGAGCCAGTTAACATTTAGGGAGTTATCTGTTTTCATCTTGAGGTGGCCAATATGGG
GATGTGGAATTTTTATACAAGTTATAAGTGTTTGGCATAGTACTTTTGGTACATTGTGGC
TTCAAAAGGGCCAGTGTAAAACTGCTTCCATGTCTAAGCAAAGAAAACTGCCTACATACT
GGTTTGTCCTGGCGGGGAATAAAAGGGATCATTGGTTCCAGTCACAGGTGTAGTAATTGT
GGGTACTTTAAGGTTTGGAGCACTTACAAGGCTGTGGTAGAATCATACCCCATGGATACC
ACATATTAAACCATGTATATCTGTGGAATACTCAATGTGTACACCTTTGACTACAGCTGC
AGAAGTGTTCCTTTAGACAAAGTTGTGACCCATTTTACTCTGGATAAGGGCAGAAACGGT
TCACATTCCATTATTTGTAAAGTTACCTGCTGTTAGCTTTCATTATTTTTGCTACACTCA
TTTTATTTGTATTTAAATGTTTTAGGCAACCTAAGAACAAATGTAAAAGTAAAGATGCAG
GAAAAATGAATTGCTTGGTATTCATTACTTCATGTATATCAAGCACAGCAGTAAAACAAA
AACCCATGTATTTAACTTTTTTTTAGGATTTTTGCTTTTGTGATTTTTTTTTTTTTGATA
CTTGCCTAACATGCATGTGCTGTAAAAATAGTTAACAGGGAAATAACTTGAGATGATGGC
TAGCTTTGTTTAATGTCTTATGAAATTTTCATGAACAATCCAAGCATAATTGTTAAGAAC
ACGTGTATTAAATTCATGTAAGTGGAATAAAAGTTTTATGAATGGACTTTTCAACTACTT
TCTCTACAGCTTTTCATGTAAATTAGTCTTGGTTCTGAAACTTCTCTAAAGGAAATTGTA
CATTTTTTGAAATTTATTCCTTATTCCCTCTTGGCAGCTAATGGGCTCTTACCAAGTTTA
AACACAAAATTTATCATAACAAAAATACTACTAATATAACTACTGTTTCCATGTCCCATG
ATCCCCTCTCTTCCTCCCCACCCTGAAAAAAATGAGTTCCTATTTTTTCTGGGAGAGGGG
GGGATTGATTAGAAAAAAATGTAGTGTGTTCCATTTAAAATTTTGGCATATGGCATTTTC
TAACTTAGGAAGCCACAATGTTCTTGGCCCATCATGACATTGGGTAGCATTAACTGTAAG
TTTTGTGCTTCCAAATCACTTTTTGGTTTTTAAGAATTTCTTGATACTCTTATAGCCTGC
CTTCAATTTTGATCCTTTATTCTTTCTATTTGTCAGGTGCACAAGATTACCTTCCTGTTT
TAGCCTTCTGTCTTGTCACCAACCATTCTTACTTGGTGGCCATGTACTTGGAAAAAGGCC
GCATGATCTTTCTGGCTCCACTCAGTGTCTAAGGCACCCTGCTTCCTTTGCTTGCATCCC
ACAGACTATTTCCCTCATCCTATTTACTGCAGCAAATCTCTCCTTAGTTGATGAGACTGT
GTTTATCTCCCTTTAAAACCCTACCTATCCTGAATGGTCTGTCATTGTCTGCCTTTAAAA
TCCTTCCTCTTTCTTCCTCCTCTATTCTCTAAATAATGATGGGGCTAAGTTATACCCAAA
GCTCACTTTACAAAATATTTCCTCAGTACTTTGCAGAAAACACCAAACAAAAATGCCATT
TTAAAAAAGGTGTATTTTTTCTTTTAGAATGTAAGCTCCTCAAGAGCAGGGACAATGTTT
TCTGTATGTTCTATTGTGCCTAGTACACTGTAAATGCTCAATAAATATTGATGATGGGAG
GCAGTGAGTCTTGATGATAAGGGTGAGAAACTGAAATCCCAAACACTGTTTTGTTGCTTG
TTTTATTATGACCTCAGATTAAATTGGGAAATATTGGCCCTTTTGAATAATTGTCCCAAA
TATTACATTCAAATAAAAGTGCAATGG

Protein Sequence

>7534 : length: 245
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN